Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51q1c Olfactory Receptor

Gene Symbol Or51q1c
Organism Mouse
Family 51
Subfamily q
Pseudo No
Location chr7:104,003,000-104,004,000 (+)
Aliases Olfr638

Sequence information


Nucleotide sequence

MLRPSSMSEVTNTTHGPFYFILTGIPGFEDIHLWISIPFFCLYTISIMGNTTILTVIRTE
PSLHEPMYLFLSMLALTDLGLTLTTLPTVMQVLWFNIREISFEACFAQVFFLHGFSFMES
SVLLAMSFDRYVAICRPLHYASILTSEVIARIGLAIICRCVLAVLPSLFLLKRLPFCHSH
LLSHSYCLHQDMIHLVCADIRVNRWYGFALVLLIIVLDPLLIVLSYALILKSVLNTATWT
ERLRALNNCLSHMLAVLVLYVPMVGVSMTHRFAKHASPLVHVLMANIYLLAPPVMNPIIY
SVKTKQIRQGITRLLLQRKVH


Conceptual translation

MLRPSSMSEVTNTTHGPFYFILTGIPGFEDIHLWISIPFFCLYTISIMGNTTILTVIRTE
PSLHEPMYLFLSMLALTDLGLTLTTLPTVMQVLWFNIREISFEACFAQVFFLHGFSFMES
SVLLAMSFDRYVAICRPLHYASILTSEVIARIGLAIICRCVLAVLPSLFLLKRLPFCHSH
LLSHSYCLHQDMIHLVCADIRVNRWYGFALVLLIIVLDPLLIVLSYALILKSVLNTATWT
ERLRALNNCLSHMLAVLVLYVPMVGVSMTHRFAKHASPLVHVLMANIYLLAPPVMNPIIY
SVKTKQIRQGITRLLLQRKVH