Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51r1 Olfactory Receptor

Gene Symbol Or51r1
Organism Mouse
Family 51
Subfamily r
Pseudo No
Location chr7:102,578,000-102,579,000 (+)
Aliases Olfr550

Sequence information


Nucleotide sequence

MFCNTSTPGHSTFLLTGFPGLEASHHWVSIPINLICVVSILGNSVILFLIRTDPALHEPM
FIFLSMLAASDLGLCASTFPTMVRLFWLGTRELPFDFCAAQMFFIHAFTYVESGVLLAMA
FDRFIAIRDPLHYATILPHSAVAKVGAAVLVRAILLNLPGPILLRRLIFPQISTLSHCYC
LHCDLVGLACSDTRINSLVGLVSILLSLGLDSSLIMLSYALILRTVLGIASPGERLKALN
TCVSHLCIVLIFYLPKLGLSVLHRVEKHSYPALAVLMANLHFLVPPFMNPVVYCIKSKQI
RQGFLRRFQQKRVDIS


Conceptual translation

MFCNTSTPGHSTFLLTGFPGLEASHHWVSIPINLICVVSILGNSVILFLIRTDPALHEPM
FIFLSMLAASDLGLCASTFPTMVRLFWLGTRELPFDFCAAQMFFIHAFTYVESGVLLAMA
FDRFIAIRDPLHYATILPHSAVAKVGAAVLVRAILLNLPGPILLRRLIFPQISTLSHCYC
LHCDLVGLACSDTRINSLVGLVSILLSLGLDSSLIMLSYALILRTVLGIASPGERLKALN
TCVSHLCIVLIFYLPKLGLSVLHRVEKHSYPALAVLMANLHFLVPPFMNPVVYCIKSKQI
RQGFLRRFQQKRVDIS