Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51s1 Olfactory Receptor

Gene Symbol Or51s1
Organism Mouse
Family 51
Subfamily s
Pseudo No
Location chr7:102,909,000-102,910,000 (-)
Aliases Olfr571

Sequence information


Nucleotide sequence

MSPLSAQDTSNISSLMAPTFLLVGLPGLEAAPSWWSVPLITIYLLSAFGNGTILWIIALE
PTLHRPMYFFLFLLSVSDVGLATVLMPTLLGLAFADAHTVPASACLLQMFFIHVFSVMES
SVLLAMAFDRAVAICRPLHYPVILTNGVISKIAVAIAFRCLSLHLPLPILLARMPYCRPQ
VLTHSYCLHPDMARLACPEAWGAVYSLVVVLSAMVLDPLLIFFSYGLIGRALQGVGSAED
RWKAGQTCAAHLSAVLLFYIPMILLALIDRFKLPLPPPAHTLLSYVHFLLPPLMNPVLYS
VKMKEIREKILKRLLPTKVGCA


Conceptual translation

MSPLSAQDTSNISSLMAPTFLLVGLPGLEAAPSWWSVPLITIYLLSAFGNGTILWIIALE
PTLHRPMYFFLFLLSVSDVGLATVLMPTLLGLAFADAHTVPASACLLQMFFIHVFSVMES
SVLLAMAFDRAVAICRPLHYPVILTNGVISKIAVAIAFRCLSLHLPLPILLARMPYCRPQ
VLTHSYCLHPDMARLACPEAWGAVYSLVVVLSAMVLDPLLIFFSYGLIGRALQGVGSAED
RWKAGQTCAAHLSAVLLFYIPMILLALIDRFKLPLPPPAHTLLSYVHFLLPPLMNPVLYS
VKMKEIREKILKRLLPTKVGCA