Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51s1 Olfactory Receptor

Gene Symbol Or51s1
Organism Rat
Family 51
Subfamily s
Pseudo No
Location chr1:168,028,000-168,029,000 (-)
Aliases Olr49

Sequence information


Nucleotide sequence

ATGTCACCATTTTCCATCCAGGAAGCCTCAAATAGCAGCACATTAATGGCTCCCACTTTC
CTGTTAGTTGGCCTTCCTGGCCTGGAAGCTACACCGTCCTGGTGGTCAGTTCCTCTCATC
ACTATCTACCTTCTCTCTGCTCTGGGCAATGGTACAGTCCTCTGGATCATTGCCCTGGAG
CCCACACTGCATCGACCAATGTACTTCTTCCTCTTCTTGCTTAGTGTGTCTGATGTTGGC
TTGGCCACAGTGCTAATGCCCACCCTGCTAGGCCTGGCCTTTACTGATGCTCACGCTATC
CCCGCCTCAGCCTGCCTTCTACAGATGTTCTTCATTCATGTCTTTTCTGTTATGGAATCC
TCTGTCTTGCTCGCCATGGCCTTTGATCGGGCAGTAGCCATCTGCCGCCCTCTTCACTAC
TCAGTCCTCCTCACCAATGGTGTCATTAGCAAGATTGCCGTAGCCATCGCTTTCCGATGC
TTGAGTCTCCATCTGCCCCTGCCATTCCTGTTGGCTCACATGCCATATTGCCGACCACAG
GTCCTGACACACTCTTACTGCTTACACCCAGATATGGTTCGCCTAGCTTGCCCAGGAACA
TGGGGTGCATTCTATAGCCTGGTTGTGGTACTGTCAGCGATGGCACTAGACCCTCTGCTT
ATCTTCTTCTCATATGGCCTGATTGGCAGAGCATTGCAAGGTGTGGGGTCTACCGAGGAT
CGCTGGAAGGCTGGTCAAACGTGTGCTGCTCACCTCTCTGCTGTGCTCCTCTTCTACACA
CCCATGATTCTCTTGGCACTCATTAACCGATTCAAGCTGCCACTCCCTCTGCCTGCCCAT
ACTCTCCTCTCCTATGTCCACTTCCTGCTCCCTCCACTGATAAACCCAGTTCTCTACAGT
GTCAAGATGAAGGAGATTAGAGAAAAAATTCTCAAGAGGTTACTACCCAGAAAGGTGGGT
TGTGCTTTG


Conceptual translation

MSPFSIQEASNSSTLMAPTFLLVGLPGLEATPSWWSVPLITIYLLSALGNGTVLWIIALE
PTLHRPMYFFLFLLSVSDVGLATVLMPTLLGLAFTDAHAIPASACLLQMFFIHVFSVMES
SVLLAMAFDRAVAICRPLHYSVLLTNGVISKIAVAIAFRCLSLHLPLPFLLAHMPYCRPQ
VLTHSYCLHPDMVRLACPGTWGAFYSLVVVLSAMALDPLLIFFSYGLIGRALQGVGSTED
RWKAGQTCAAHLSAVLLFYTPMILLALINRFKLPLPLPAHTLLSYVHFLLPPLINPVLYS
VKMKEIREKILKRLLPRKVGCAL