Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51t4 Olfactory Receptor

Gene Symbol Or51t4
Organism Mouse
Family 51
Subfamily t
Pseudo No
Location chr7:102,948,000-102,950,000 (+)
Aliases Olfr574

Sequence information


Nucleotide sequence

MINNITAMFFRVCLQVTMLIFNNTTSPSSSSFLLTAFPGLELAHVWISIPVCGLYTIALL
GNSIILFVIIIERSLHKPMYYFLSMLSVVDLGLTITTLPTVLGVLWFHAREISIKVCLIQ
MFFVHGFSFLESSVLVAMAFDRYLAICSPLKYATFLTDMMSFVIGLIICIRQVFFMFPSV
MAVKSVSFQGGQELSHPFCFHPDIIKYTYTNPWISSFWGMFLQLYLNGTDLLFILFSYVL
ILRTVLNIVAPQKQQKALSTCVCHICAVTIFYVPMITLSVAHRLFSSTPRVICSILGNMY
LLLPPVLNPIIYSLKTKVIRQAIFQLFRFKDARGYSMRSLRGRWARRRQFSST


Conceptual translation

MINNITAMFFRVCLQVTMLIFNNTTSPSSSSFLLTAFPGLELAHVWISIPVCGLYTIALL
GNSIILFVIIIERSLHKPMYYFLSMLSVVDLGLTITTLPTVLGVLWFHAREISIKVCLIQ
MFFVHGFSFLESSVLVAMAFDRYLAICSPLKYATFLTDMMSFVIGLIICIRQVFFMFPSV
MAVKSVSFQGGQELSHPFCFHPDIIKYTYTNPWISSFWGMFLQLYLNGTDLLFILFSYVL
ILRTVLNIVAPQKQQKALSTCVCHICAVTIFYVPMITLSVAHRLFSSTPRVICSILGNMY
LLLPPVLNPIIYSLKTKVIRQAIFQLFRFKDARGYSMRSLRGRWARRRQFSST