Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51v14 Olfactory Receptor

Gene Symbol Or51v14
Organism Mouse
Family 51
Subfamily v
Pseudo No
Location chr7:103,611,000-103,612,000 (-)
Aliases Olfr620

Sequence information


Nucleotide sequence

MTALSVTNYTSSRFALTGFPGLEIYYFWISVPFFIIYVTVFLGNCMVLHVIRTELSLHQP
MFYFLAMLALTDLCMGLSTVHTVMGILWGFLQEISLDACIAQSYFIHGLSFMESSVLLAM
SFDRYIAICNPLRYSSILTNDRILKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSF
CLHQDLIRMACGDIRFNSIYGLALVISNLLVDSVLILISYIMILYTVLSIASREERIKSL
QTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNVYILFPPLMNPIIYSIKTQQ
IRVRIQRLFLKGT


Conceptual translation

MTALSVTNYTSSRFALTGFPGLEIYYFWISVPFFIIYVTVFLGNCMVLHVIRTELSLHQP
MFYFLAMLALTDLCMGLSTVHTVMGILWGFLQEISLDACIAQSYFIHGLSFMESSVLLAM
SFDRYIAICNPLRYSSILTNDRILKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSF
CLHQDLIRMACGDIRFNSIYGLALVISNLLVDSVLILISYIMILYTVLSIASREERIKSL
QTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNVYILFPPLMNPIIYSIKTQQ
IRVRIQRLFLKGT