Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51v15-ps Olfactory Receptor

Gene Symbol Or51v15-ps
Organism Mouse
Family 51
Subfamily v
Pseudo Yes
Location chr7:103629018-103629943 (-)
Aliases Olfr621-ps1, MOR4-3P, MOR4-4_p

Sequence information


Nucleotide sequence

ATGTCAAACTTAAGTACCTCTAGATTTGTTCTCACTGGATTTCCGGGCCTGGAATTCTAC
TACATCTTGCTTGCCATTCCTTTCTCAACCGTCTATGCAATGGTGTTCCTGGGAAACTGC
ATGATACTTCATGTGATCCGAACAGAGTCAAGCCTGCACCAGCCCATGTTCTATTTTCTG
GCCATGCTAGCCCTCACAGACCTATGCATGGGGCTGTCCACTGTGCACACAGTGCTGGGC
ATCCTTTGGGGCTTCCTTCAAGAGATCAGCCTTGATGCCTGCATTGCACAGTCTTACTTC
ATCCATGGTTTGTCCATCATGGAGTCCTCCTCGCCATGTCCTTTGATCGCTACATTGCCA
TTTGCAACCCTCTACGCTATTCCTCCATCCTAACCAATGACAGAATCCTGAAAATCGGAG
TGGCCATCTTATGTAGGAGTTCTATGCTCATTCCTCCAGTTATTATCCGCCTGAAGTTCT
TAAATTACTGCAGGCCTCATTTCCTCTCCCACTCTTTCTGCCTGCACCAAGACTTGATTC
GAATGGCTTGTTCAGATATCTGCTTTAACAGTTTCTATGCTCCGTCTGTGGTGATTTGCA
CCCTGTTACTGGATGCAGTGCTCATTCTTGCCTCCTACGTGATGATCCTGCACACAGTTC
TATCGATTGCATCCAGGGAGGAGAGAATCAAGTCTTTGCAAACATGTGTATCTCACATCT
CTGCTGTTTTGGTTTTCTACATCCCCATCATTGGTCTGACTATGGTTCACCGCTTTGGGA
AGCATCTCTCTCCTCTGGTTCAGGTCCTCATGGGCAACATTTATATCCTTTTCCCACCCT
TTATGAACCCCATTATATACAGTATCAAAACTCAGCAGATTCGAGTGAGAATTGGGAGAC
TGTTTACTTTGAAAGGAACCCAAGTC


Conceptual translation

MSNLSTSRFVLTGFPGLEFYYILLAIPFSTVYAMVFLGNCMILHVIRTESSLHQPMFYFL
AMLALTDLCMGLSTVHTVLGILWGFLQEISLDACIAQSYFI/WFVHHGVLLAMSFDRYI
AICNPLRYSSILTNDRILKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSFCLHQDL
IRMACSDICFNSFYAPSVVICTLLLDAVLILASYVMILHTVLSIASREERIKSLQTCVSH
ISAVLVFYIPIIGLTMVHRFGKHLSPLVQVLMGNIYILFPPFMNPIIYSIKTQQIRVRIG
RLFTLKGTQV