Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51v16-ps Olfactory Receptor

Gene Symbol Or51v16-ps
Organism Mouse
Family 51
Subfamily v
Pseudo Yes
Location chr7:103691755-103692102 (-)
Aliases Olfr626-ps1, MOR177-11P

Sequence information


Nucleotide sequence

ATGTCAAACTTAAGTACCTCTAGATTTGTTCTTACTAAATTTCCTGGCCTGGAAGTCTAC
TACATCTTGTTTGCCATTCCTTTCTCAACCATCTATGCAATGGTGTTCCCAGGAAACTGC
ATGACACTTCATGTGATCCAAACAGAGCCAAGCCTACACCAGCCCATGTTCTAATTCCTG
GGAATGTTAGCCCTCACAGACCTATGCATGGGGCTGTCTACTGTGAACACGGTGCTGGGA
ATTTTGGGGGGCTTCCTTCAAGAGATCAGCCTTGATGCCTGCATTTACTACAGTAAAGGT
AATGGTTGTCAGAAATTTGTGTTTGTAAACATCAACTTCAAACCTTAT


Conceptual translation

MSNLSTSRFVLTKFPGLEVYYILFAIPFSTIYAMVFPGNCMTLHVIQTEPSLHQPMF*FL
GMLALTDLCMGLSTVNTVLGILGGFLQEISLDACIYYSKGNGCQKFVFVNINFKPY