Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51v17-ps Olfactory Receptor

Gene Symbol Or51v17-ps
Organism Rat
Family 51
Subfamily v
Pseudo Yes
Location chr1:168,755,000-168,757,000 (-)
Aliases Olr117-ps

Sequence information


Conceptual translation

LKSKSISRFVLTGFPGLEVYFILFAIPFSSIYAMVFLGNCILHVI*TEPSLHQPRFYFLA
/VTLTDLCMGLSTVHTEASFGASFKK*DACVAQSYFIHSLSCMESSVLFLMFFDQYKAI
CNPLCYSSIPTKDQNIKIGVAILCGSPMSIPLVIICLKFLNYCRSHFLSQTFLNWISFYL
HFKCY/PFPFSWVLAVYPIPLPFFYKGIPLPTHSSPSRLHQDLIRLSCSDIRFNSFYAL
SLVICTLLLDAVLILASYVMILHTVLSIASREERIKSLQTCVSHISAVLVFYIPIIGLTM
VHSFVDI/SPLVQVLMGNIYILFPPLMNPIIYSVRL\DTSECPETVF