Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51v8 Olfactory Receptor

Gene Symbol Or51v8
Organism Mouse
Family 51
Subfamily v
Pseudo No
Location chr7:103,670,000-103,671,000 (-)
Aliases Olfr624

Sequence information


Nucleotide sequence

MSNLSTSRFVLTGFPGLEVYYFFAIPFSTIYAMVFLGNCMILHVIRTESSLHQPMFYFLA
MLALTDLCMGLSTVHTVLGILWGFLQEISLDACIAQSYFIHGLSFMESSVLLAMSFDRYI
AICNPLRYSSILTNDRILKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSFCLHQDL
IRMACSDIRFNSFYALSLVICTLLLDAVLILASYVMILHTVLSIASREERIKSLQTCVSH
ISAVLVFYIPIIGLTMVHRFGKHLSPLVQVLMGNIYILFPPLMNPIIYSIKTQQIRVRIQ
RLFSLNGI