Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51v8 Olfactory Receptor

Gene Symbol Or51v8
Organism Rat
Family 51
Subfamily v
Pseudo No
Location chr1:168,802,000-168,803,000 (-)
Aliases Olr120

Sequence information


Nucleotide sequence

ATGTCTCTTTTTTTGATGTCAAACTTAAGTACCTCTAGATTTGTTCTCACTGGATTTCCT
GGCCTGGAAGTCTACTATATCTTGTTTGCCATTCCTTTCTCAGTCATCTATGCAATGGTG
TTCCTGGGAAACTGCATGATACTTCATGTGATCCGGACAGAGCCAAGCCTGCACCAGCCC
ATGTTCTATTTCCTGGCCATGTTAGCCCTCACAGACCTTTGCATGGGGCTGTCCACTGTG
CACACAGTGCTGGGCATCCTTTGGAGCTTCCTTCAAGAGATCAGCCTTGATGCCTGCATT
GCACAGTCTTACTTCATTCATGGTTTGTCCTTCATGGAGTCCTCCGTTCTACTCGCCATG
TCCTTTGACTGCTACATTGCCATTTGCAATCCTCTACGCTATTCCTCCATCCTAACCAAT
GACAGAATCATAAAGATTGGAGTGGCCATCTTATGTAGGAGTTCTATGCTCATTCCTCCG
GTTATTATCCGCCTGAAGTTCTTAAATTACTGCCGGCCTCATTTCCTCTCCCACTCTTTC
TGCCTGCACCAAGACTTGATTCGACTGTCATGTTCAGATATCCGCTTTAACAGTTTCTAT
GCTCTGTCTCTGGTGATTTGCACCCTGTTGCTGGATGCAGTGCTCATTCTTGCCTCCTAT
GTGATGATCCTGCACACAGTTCTGTCCATTGCATCCCGGGAGGAGAGAATCAAGTCTTTG
CAAACGTGTGTATCTCACATTTCTGCCGTTTTGGTTTTCTACATCCCCATCATTGGTCTG
ACCATGGTTCACCGTTTTGGGAAGCATCTCTCTCCACTGGTTCAGGTCCTCATGGGCAAC
ATTTACATCCTTTTCCCACCCTTGATGAACCCCATTATATATAGTATCAAGACTCAACAG
ATACGAGTGAGAATCCAGAGACTGTTTTCCTTGAATGGAACC


Conceptual translation

MSLFLMSNLSTSRFVLTGFPGLEVYYILFAIPFSVIYAMVFLGNCMILHVIRTEPSLHQP
MFYFLAMLALTDLCMGLSTVHTVLGILWSFLQEISLDACIAQSYFIHGLSFMESSVLLAM
SFDCYIAICNPLRYSSILTNDRIIKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSF
CLHQDLIRLSCSDIRFNSFYALSLVICTLLLDAVLILASYVMILHTVLSIASREERIKSL
QTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVQVLMGNIYILFPPLMNPIIYSIKTQQ
IRVRIQRLFSLNGT