Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51v8b Olfactory Receptor

Gene Symbol Or51v8b
Organism Rat
Family 51
Subfamily v
Pseudo No
Location chr1:168,710,000-168,710,000 (-)
Aliases Olr114

Sequence information


Nucleotide sequence

ATGTCTATTTTCTTGATGTCAAACTCAAGCATGTCTATATTTGTTCTCACTGGATTTCCT
GGCCTGGAAGTCTACTTCGTCTTATTTGCCATTCCTTTCTCAGTAATCTATGCAATGGTG
TTCCTGGGAAACTGCATGATACTTCATGTGATCCGGACAGAGCCAAGCCTGCACCAGCCC
ATGTTCTATTTCCTGGCCATGTTAGCCCTCACAGACCTTTGCATGGGGCTGTCCACTGTG
CACACAGTGCTGGGCATCCTTTGGGGCTTCCTTCAAGAGATCAGCCTTGATGCCTGCATT
GCACAGTCTTACTTCATTCACGGTTTGTCCTGCATGGAGTCCTCGGTCCTCCTCGCCATG
TCCTTTGACCGCTACATTGCTATTTGCAACCCTCTACGCTATTCCTCCATCCTAACCAAT
GACAGAATCATAAAAATTGGAGTGGCCATTTTATGTAGGAGTTCTATGCTCATTCCTCCA
GGTATTATTCGCCTGAAGTTCTTAAATTACTGCCGGTCTCATATCCTCTCCCACTCTTTC
TGCCTGCACCAAGACTTGATTCGACTGTCATGTTCAGATATCCGCTTTAACAGTTTCTAT
GCTCTGTCTCTGGTGATTTGCACCCTGTTGCTGGATGCAGTGCTCATTCTTGCCTCCTAT
GTGATGATCCTGCACACAGTTCTGTCCATTGCATCCCGGGAGGAGAGAATCAAGTCTTTG
CAAACGTGTGTATCTCACATCTCTGCTGTTTTGGTTTTCTACATCCCCATCATTGGTCTG
ACCATGGTTCACCGCTTTGGAAAGCATCTCTCTCCATTAGTTCATGTCCTTATGGGAAAC
GTCTACATCCTTTTCCCACCCTTGATGAACCCCATTATATACAGTATCAAGACTCAACAG
ATACGAGTGAGAATCCAGAGACTGTTTTCCTTGAATGGAACC


Conceptual translation

MSIFLMSNSSMSIFVLTGFPGLEVYFVLFAIPFSVIYAMVFLGNCMILHVIRTEPSLHQP
MFYFLAMLALTDLCMGLSTVHTVLGILWGFLQEISLDACIAQSYFIHGLSCMESSVLLAM
SFDRYIAICNPLRYSSILTNDRIIKIGVAILCRSSMLIPPGIIRLKFLNYCRSHILSHSF
CLHQDLIRLSCSDIRFNSFYALSLVICTLLLDAVLILASYVMILHTVLSIASREERIKSL
QTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNVYILFPPLMNPIIYSIKTQQ
IRVRIQRLFSLNGT