Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52a20 Olfactory Receptor

Gene Symbol Or52a20
Organism Rat
Family 52
Subfamily a
Pseudo No
Location chr1:168,830,000-168,831,000 (+)
Aliases Olr122

Sequence information


Nucleotide sequence

ATGCCTCATCCCAACAGCACCATCTTCAGGCCTTCAGTGCTGACTCTGACTGGGATCCCA
GGTTTGGAGTCTGTGCAGTTCTGGATTGGGATTCCCTTCTGTATCATGTACATCATTGCA
CTTTTGGGGAATTCTCTGCTTCTAGTTGTCATCAAAGTTGAGCGAAGCCTCCATGAGCCC
ATGTACCTCTTCCTAGCAATGCTTGGCGCAACAGACATTGCTCTCAGTACGTGCATCTTA
CCGAAAATGCTAGGGATATTCTGGTTTCACCTTCCAACCATATACTTTGATGCCTGCCTC
TTACAGATGTGGCTGATACACACATTCCAATGTATTGAGTCCGGCATCTTGTTTGCCATG
GCCATGGACCGCTATGTGGCCATCTGTGATCCTCTAAGACATGCATCCGTCTTTACCCAG
AGACTCCTCACTCAGATAGCAGTTGGAGTCACACTCAGAGCAGCCCTGTTTGTAGCTCCA
TGTCTCATTCTCATCAAATGCAGGTTGAGACTCTACTGGACCACTGTTGTGTCGCACTCA
TACTGTGAGCACATGGCCATTGTGAAGCTGGCAGCAGAAGATATCCGTGTCAACAAGATC
TATGGTCTGTTTGTGGCCTTCAGTATCCTTGGACTGGACATCATTTTCATCACACTCTCC
TACATTAGAATATTTATAACTGTCTTCAGGCTCCCTCAAAAGGAAGCAAGATTCAAAGCC
TTTAACACGTGCATTGCTCACATTTGTGTCTTCTTGGAGTTTTACCTTCTGGCCTTCTTC
TCCTTCTTTACACATAGGTTTGGCTTTCACATCCCATCCTACATTCACATTCTCCTGTCC
AACCTTTACCTACTTGTCCCGCCTTTGCTCAATGCTATTGTTTATGGTGTGAAGACCAAA
CAAATTCGTGACCAAGTGTCCAAAATTTTGTATTGTAATTATTCTTCT


Conceptual translation

MPHPNSTIFRPSVLTLTGIPGLESVQFWIGIPFCIMYIIALLGNSLLLVVIKVERSLHEP
MYLFLAMLGATDIALSTCILPKMLGIFWFHLPTIYFDACLLQMWLIHTFQCIESGILFAM
AMDRYVAICDPLRHASVFTQRLLTQIAVGVTLRAALFVAPCLILIKCRLRLYWTTVVSHS
YCEHMAIVKLAAEDIRVNKIYGLFVAFSILGLDIIFITLSYIRIFITVFRLPQKEARFKA
FNTCIAHICVFLEFYLLAFFSFFTHRFGFHIPSYIHILLSNLYLLVPPLLNAIVYGVKTK
QIRDQVSKILYCNYSS