Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52a24 Olfactory Receptor

Gene Symbol Or52a24
Organism Mouse
Family 52
Subfamily a
Pseudo No
Location chr7:103,732,000-103,733,000 (+)
Aliases Olfr628

Sequence information


Nucleotide sequence

MPHLNSTIFRPSVLTLTGIPGLESVQFWIGIPFCIMYIIALLGNSLLLVVIKVERSLHEP
MYLFLAMLGATDISLSTSILPKMLGIFWFHLPTIYFDACLLQMWLIHTFQGIESGILFAM
AMDRYVAICYPLRHASIFTQRLLTQIGVGVTLRAALFVAPCLFLIKCRLKFYWTTVVSHS
YCEHMAIVKLAAEDVHVNKIYGLFVAFSILGLDIIFITLSYIRIFITVFKLPQKEARLKA
FNTCVAHICVFLEFYLLAFFSFFTHRFGYHVPSYIHILLSNLYLLVPPLLNPIVYGVKTK
QIRDQVSKILYCNYSY