Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52a5b Olfactory Receptor

Gene Symbol Or52a5b
Organism Mouse
Family 52
Subfamily a
Pseudo No
Location chr7:103,767,000-103,768,000 (-)
Aliases Olfr69

Sequence information


Nucleotide sequence

MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIP
MYIFLAILAVTDIALSTCILPKMLGIFWFHMPQISFDACLLQMELIHSFQATESGILLAM
ALDRYVAICNPLRHATIFSPQLTTCLGAGALLRSLITTFPLILLIKCRLKYFRTTIISHS
YCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFSYVRIFITVFQLPQKEARFKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGAHIPPYVHILLSDLYLLVPPFLNPIVYGVKTK
QIRDQVLKMLFSKKPL


Conceptual translation

MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIP
MYIFLAILAVTDIALSTCILPKMLGIFWFHMPQISFDACLLQMELIHSFQATESGILLAM
ALDRYVAICNPLRHATIFSPQLTTCLGAGALLRSLITTFPLILLIKCRLKYFRTTIISHS
YCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFSYVRIFITVFQLPQKEARFKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGAHIPPYVHILLSDLYLLVPPFLNPIVYGVKTK
QIRDQVLKMLFSKKPL