Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52ab4 Olfactory Receptor

Gene Symbol Or52ab4
Organism Mouse
Family 52
Subfamily ab
Pseudo No
Location chr7:103338056-103339000 (+)
Aliases Olfr599, MOR23-1

Sequence information


Nucleotide sequence

ATGGGCTATACCAACTTGTCATACCTGAACCCAGGGACAGTGATTCTGATTGGCATCCCT
GGACTGGAGCATGTGCAGTTTTGGATTGGATTTCCCTTCTTTGTTGTATGCCTTGTGGCT
TTGCTGGGAAACCTCTTCCTGCTAATCATTATCCCCACAGAACGCAGTCTACACCAACCC
ATGTACATTTTCTTGGCAGTACTCGCAGCTACTGACCTTGGTCTCTGCCTAGCCATTGCC
CCTAAGATGTTGGCCATCTTCTGGTTTGGCTCCTGTTCCATGGCTTTTGATGCTTGCCTC
ACCCAGCTCTTCTTCATCCATGCCTTGCAAGGAATGGAATCTGGCGTTCTGCTTGCCATG
GCCTTTGACCGATATGTCGCCATCTGCGATCCTCTGAGGCACACAGCCGTCCTTACACCT
TTATTTTTACTTAGAGTCGTTCTGGTGGTTGCAATTCGGGCAACTGTACTCGTTGGGGTT
TTACCCATTCTCCTCAAGCGACTGCAATGGTTCCACTCTGTTGTGATTGTTCATTCTTAC
TGTGAGCACATGGCTGTAGTCAAGCTGGCGGCAGAAGATGTCCGTATTAATAAATCATAT
GGGCTCTTTGTGGCTTTTGCAATTCTAGGTTTTGACATGATATTTGTTTTCATCTCCTAC
ATTTTGATTTTCCGAGCTGTTTTTCGTCTTCCTCAGAAAGAGGCACGAAGCAAAGCATTC
AACACTTGTACGGCTCATATTGTTGTCTTCCTGGAGTTTTATATCCTTGCCTTTTTTTCC
TTTTTCAGTCACCGTTTTGGTCACGTATCACCGTATGTCCACATCTTATTGTCTACCATC
TATCTACTTCTGCCCCCGGCCCTTAACCCCATTGTGTATGGTGTGAAGACCAAGGAGATC
CGCAAATGGGTTGTCCAAATTTTTGTTCTGAAGTCTAATACTCAG


Conceptual translation

MGYTNLSYLNPGTVILIGIPGLEHVQFWIGFPFFVVCLVALLGNLFLLIIIPTERSLHQP
MYIFLAVLAATDLGLCLAIAPKMLAIFWFGSCSMAFDACLTQLFFIHALQGMESGVLLAM
AFDRYVAICDPLRHTAVLTPLFLLRVVLVVAIRATVLVGVLPILLKRLQWFHSVVIVHSY
CEHMAVVKLAAEDVRINKSYGLFVAFAILGFDMIFVFISYILIFRAVFRLPQKEARSKAF
NTCTAHIVVFLEFYILAFFSFFSHRFGHVSPYVHILLSTIYLLLPPALNPIVYGVKTKEI
RKWVVQIFVLKSNTQ