Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52ab4 Olfactory Receptor

Gene Symbol Or52ab4
Organism Rat
Family 52
Subfamily ab
Pseudo No
Location chr1:168,448,000-168,448,000 (+)
Aliases Olr91

Sequence information


Nucleotide sequence

ATGACAGGATTTTTCAGATTCATGGGCTATACCAACTTGTCATATCTGAACCCAAGGACA
GTGATTCTGGTTGGCATCCCTGGACTAGAGCATGTGCAGTTTTGGATTGGATTTCCCTTC
TTTGTTGTATGTCTTGTGGCTTTGCTGGGAAACCTTTTCCTGCTAATCATTGTTCCCAGA
GAACGCAGCCTACACCAACCCATGTACATTTTCTTGGCAGTACTGGCAGCTACTGACCTT
GGTCTCTGTTTAGCCATTGCTCCTAAGATGTTGGCCATCTTCTGGTTTGGTTCATGTTCT
ATGGCTTTTGATACTTGCCTCACCCAGCTCTTCTTCATCCATGCCTTGCAAGGAATGGAA
TCTGGCATTCTGCTCGCCATGGCTTTTGACAGATACGTCGCCATCTGTGACCCTCTGAGG
CACCCATCCATCCTTACACCTTTATTTTTACTTCGAGTCATTCTGATGGTTGCAGTCCGG
GCAACTGTACTTGTTGGGATTTTACCTGTTCTCCTCAAGCGACTGCAACGGTTCCACTCC
ATTGTGATCGTTCATTCTTATTGTGAGCACATGGCTGTCGTCAAGCTGGCAGCAGAAGAT
GTCACTATTAATAAATCATATGGGCTCTTTGTGGCTTTTGCAATTCTGGGCTTTGACATG
ATATTCGTTTTCATCTCCTACTTTTTGATTTTCCAAGCTGTTTTACATCTTCCTCAGAAA
GAGGCACGGAGCAAAGCTTTCAATACTTGTACAGCTCATATTGTTGTCTTCCTAGAGTTT
TATATCCTTGCCTTTTTTTCCTTTTTCAGTCACCGTTTTGGTCATGTGTCACCGTATATC
CATATCTTATTGTCTACCATCTATCTGCTCCTGCCCCCTGCCCTTAACCCTATTGTCTAT
GGTGTGAAGACAAAGGAGATCCGCAAATGGGTTGTACACATTTTTGTTTTGAAGTCTAAT
ACTCAA


Conceptual translation

MTGFFRFMGYTNLSYLNPRTVILVGIPGLEHVQFWIGFPFFVVCLVALLGNLFLLIIVPR
ERSLHQPMYIFLAVLAATDLGLCLAIAPKMLAIFWFGSCSMAFDTCLTQLFFIHALQGME
SGILLAMAFDRYVAICDPLRHPSILTPLFLLRVILMVAVRATVLVGILPVLLKRLQRFHS
IVIVHSYCEHMAVVKLAAEDVTINKSYGLFVAFAILGFDMIFVFISYFLIFQAVLHLPQK
EARSKAFNTCTAHIVVFLEFYILAFFSFFSHRFGHVSPYIHILLSTIYLLLPPALNPIVY
GVKTKEIRKWVVHIFVLKSNTQ