Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52ac1 Olfactory Receptor

Gene Symbol Or52ac1
Organism Mouse
Family 52
Subfamily ac
Pseudo No
Location chr7:104596256-104597179 (-)
Aliases Olfr655, MOR38-1

Sequence information


Nucleotide sequence

ATGTTAATCTTCAACCACTCCAGTTTCATGACTTTCACTCTTTTGGGAGTGCCCGGCTTA
GAATCCCAACACTTGTGGCTCTCTGTTCCATTCACTTCTATGCTCTTGGCCATCCTCATT
GGCAATGGTGCTATCCTCTTCTTGGTTATCACAGAGCCCACACTTCACACACCAATGTAT
CTGCTCCTGGCCCTGCTGATGGTGGCTGACCTCATCTCTACTCTAGCTCTTGTGCCCAAG
GTCCTGTGCCTCTTCTGGTTTGATGATCGAGTCATAGCCATCTATGCCTGTTTCACACAG
ATGTTCTTCATTCATGGAGCTTCAGTGGTACGATCAGCCCTACTTGTTGCAATGGCCTTT
GACCGCTTTGTGGCTGTGTGTGAGCCACTACGCTACAACACAATTTTAAGCCATTCTCTA
GTTGGACGCCTAGGACTGGTGGCACTTGCCAAGGGTGTCATCCTTATCCTGCCCATGCCT
CTTCTACTTCAAAGGCTGACTTTCTGTCACAGGGTCATTCCCCACACATACTGTGACCAT
ATGGCTGTGGTAAAAATGGCCTGTAGTAACACCAGACCAAATCGGATTTATGGGCTCTTC
GTGATCTTGCTTGTAGTGGGACTCGATCTGCTTCTAATTGGTTTCTCGTATGTCTTCATC
CTGCAGAGTGTGGTACGCCTCAACTCTCGAGATGCCACCTTCAAAGCCCTCAATACATGC
TCAGCCCACCTCTTTGTTATTCTCATCACTTATGTACCTGCACTGTTTTCATCCATCACC
CACCGCATCGGCCACCATATTCCACCTCATGCTCACATTATTCTTGCCAATCTCTACCTT
CTCATACCTTCGGTGTTCAACCCAATTATCTACGGTATTAAAATGAAGGAGATACGGGAC
AGAGTGGCCAAATGCTTGTGCAGA


Conceptual translation

MLIFNHSSFMTFTLLGVPGLESQHLWLSVPFTSMLLAILIGNGAILFLVITEPTLHTPMY
LLLALLMVADLISTLALVPKVLCLFWFDDRVIAIYACFTQMFFIHGASVVRSALLVAMAF
DRFVAVCEPLRYNTILSHSLVGRLGLVALAKGVILILPMPLLLQRLTFCHRVIPHTYCDH
MAVVKMACSNTRPNRIYGLFVILLVVGLDLLLIGFSYVFILQSVVRLNSRDATFKALNTC
SAHLFVILITYVPALFSSITHRIGHHIPPHAHIILANLYLLIPSVFNPIIYGIKMKEIRD
RVAKCLCR