Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52ad1 Olfactory Receptor

Gene Symbol Or52ad1
Organism Mouse
Family 52
Subfamily ad
Pseudo No
Location chr7:103,346,000-103,347,000 (-)
Aliases Olfr600

Sequence information


Nucleotide sequence

MPSCNNSIPQPLIFILAGIPDLESSHGWFSISFFLIFVVTIIGNVTILHIIWIEKTLHEP
MFLLLATLSVVDLCLVTVTVPRMLGIFWLNAKEISLEACLTQMFFIPSFYVMESGILLAM
AFDRFAAIWYPLRYTTILDSNMLVKMALAILARAVAVVTPAPILTKRLERFQTQVISYSY
CAYMAVVMIACGDISNHIVYGLMVIVASVGIDLLLVILSYTLILRAVFHIPSWQARSKAL
STCGSHLCVIGLFYSPVVFSVLSQILGYHMAPYLQIIIDNLYFLVPPMVNPLIYAVRTKQ
IRERVLRILNCERK


Conceptual translation

MPSCNNSIPQPLIFILAGIPDLESSHGWFSISFFLIFVVTIIGNVTILHIIWIEKTLHEP
MFLLLATLSVVDLCLVTVTVPRMLGIFWLNAKEISLEACLTQMFFIPSFYVMESGILLAM
AFDRFAAIWYPLRYTTILDSNMLVKMALAILARAVAVVTPAPILTKRLERFQTQVISYSY
CAYMAVVMIACGDISNHIVYGLMVIVASVGIDLLLVILSYTLILRAVFHIPSWQARSKAL
STCGSHLCVIGLFYSPVVFSVLSQILGYHMAPYLQIIIDNLYFLVPPMVNPLIYAVRTKQ
IRERVLRILNCERK