Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52ad1 Olfactory Receptor

Gene Symbol Or52ad1
Organism Rat
Family 52
Subfamily ad
Pseudo No
Location chr1:168,455,000-168,456,000 (-)
Aliases Olr92

Sequence information


Nucleotide sequence

ATGCCCTCATGTAATAACTCCATTCCTCAGCCCTTGATATTCATCCTGACCGGAATCCCA
GGCCTCGAATCCTCCCATGGCTGGTTCTCAACGTTCTTTTTCTTGATATTTGTAATAACC
ATCATAGGAAATGGCACCATTTTAAATATAATTTGGATAGAGAAGACTCTCCATGAGCCA
ATGTTTCTCCTCTTGGCTACACTATCAGTTGTGGACTTGTGCCTGGTTACAGTCACTGTA
CCCCGAATGCTAGGAATCTTCTGGATGAATGCCAAAGAAATCAGCCTTGAGGCCTGCCTC
ACACAGATGTTTTTCATCCCTTCCTTTTATGTCATGGAATCGGGGATCCTCTTGGCCATG
GCCTTTGATAGATTTGCAGCTATCTGGTACCCTTTGAGGTACACAACCATCCTGGACAGA
AACATGCTTGTGAAGATGGCACTGGCTATACTGGCAAGGGCAGTGGCCGTGGTCACCCCT
GCCCCCATCCTAACTAAAAGGCTGGAACGATTCCAAACACAGGTCATCAGTTATTCCTAC
TGTGCCTACATGGCTGTGGTGATGATTGCTTGTGGAGACATCTCCAACCACGTTGTCTAC
GGCCTCATGGTTATTGTAGCATCTGTGGGGATTGATCTCCTTTTTGTCATTCTGTCCTAT
ACTCTGATCCTTTGTGCTGTCTTTCGTATTCCATCTGGGCAAGCCAGGAGAAAAGCTCTC
AGCACATGTGGTTCTCATCTGTGTGTCATTGGTCTGTTTTATTCTCCAGTTGTCTTTTCT
GTCTTATCCCAGATTTTAGGGTACCATATGGCTCCCTACTTACAGATTATAATCGACAAT
TTGTATTTTCTGGTGCCTCCTATGGTCAACCCCTTAATATATGCAGCCCGAACCAAACAG
ATGAGGGAGCGGGTGTTGCGTGTACTGACCTGTCAGAGAAAC


Conceptual translation

MPSCNNSIPQPLIFILTGIPGLESSHGWFSTFFFLIFVITIIGNGTILNIIWIEKTLHEP
MFLLLATLSVVDLCLVTVTVPRMLGIFWMNAKEISLEACLTQMFFIPSFYVMESGILLAM
AFDRFAAIWYPLRYTTILDRNMLVKMALAILARAVAVVTPAPILTKRLERFQTQVISYSY
CAYMAVVMIACGDISNHVVYGLMVIVASVGIDLLFVILSYTLILCAVFRIPSGQARRKAL
STCGSHLCVIGLFYSPVVFSVLSQILGYHMAPYLQIIIDNLYFLVPPMVNPLIYAARTKQ
MRERVLRVLTCQRN