Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52ae10-ps Olfactory Receptor

Gene Symbol Or52ae10-ps
Organism Rat
Family 52
Subfamily ae
Pseudo Yes
Location chr1:168,546,000-168,547,000 (+)
Aliases Olr101

Sequence information


Nucleotide sequence

ATGGTAAATAATACAACACATCACTATATTTCATATTTCTATCTGGTTGGTATTCCTGGC
TTGGAAAAATTTCACTCCTTGATCAGCATCCCTGTTTGTCTCCTGTTTGTCCTGACACTA
CTGGGGAATAGTATAGTCATTGCTACTATCAAAGTAGAACCAAGCCTCCACCAGCCTATG
TATTTCTTCCTTGGCATGCTGGGAATGAATGACATTTTTCTTACTTGTTCCACATCCTTG
AAAATGCTTGATATATTCTGGTTTAATGAACACTGGATTGAGTTTGATGTCTGTCTAACA
CAAATGTATTTTATCCACATGTTTTGCGCCTTTGAGTCAGCCATCCTGGTGGCCATGGCC
TTTGATCGCTTCGTGGCCATTTGCATCCCACTGCACTACTCGACCATCCTCACAACAACC
ATGGTTATTAAACTGGGTGTAGTTGGCTTGAGCCGAGCTGTGCTCATAGTTTTTCCATGT
CCTCTACTCATTAAGAGGCTGCCCTACTACACAAGTTATATAATCCCTCATGCCTACTGT
GAGCATATGGCTGTGGTGAAGTTAGCCAGTGCTAACACTCTCATTAACAGAGCATATGGA
ATCTCAGCAGCCTTTGCAGTAACAATATTG


Conceptual translation

MVNNTTHHYISYFYLVGIPGLEKFHSLISIPVCLLFVLTLLGNSIVIATIKVEPSLHQPM
YFFLGMLGMNDIFLTCSTSLKMLDIFWFNEHWIEFDVCLTQMYFIHMFCAFESAILVAMA
FDRFVAICIPLHYSTILTTTMVIKLGVVGLSRAVLIVFPCPLLIKRLPYYTSYIIPHAYC
EHMAVVKLASANTLINRAYGISAAFAVTI/GLIVFPCPLLIKRLPYYTSYIIPHAYCEH
MAVVKLASANTLINRAYGISAAFAVTILDIWLIATSYIKILQAVFRLSSQNARSKALGTC
AAHICTILAFYTPALFSFLTHRIGKNVSPSVHIILASLYLLVPPTVNPLVYGVKTKQIRD
RVLSLFSHLKTTE