Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52ae7 Olfactory Receptor

Gene Symbol Or52ae7
Organism Mouse
Family 52
Subfamily ae
Pseudo No
Location chr7:103,470,000-103,471,000 (+)
Aliases Olfr608

Sequence information


Nucleotide sequence

MVNDTTHHYISFFYLVGIPGFENFHYLISIPVCLLFVLTLLGNSIVIATIKLEPSLHQPM
YFFLCMLAMNDILLTCSTSLKMLGIFWFNEHWIEFDVCLTQMYFIHTLCIFESAILVAMA
FDRFVAICIPLHYATILTTAMVIKLGVVGLSRALLMVLPCPLLIKRLPYYTGYIIPHTYC
EHMAVVKLASANTFINRAYGISAALSVITLDVWLIAASYIKILQAVFRLSSQNARSKALG
TCAAHVCTILAFYTPALFSFLTHRIGKNVPPSVHIILASMYLLVPPTVNPLVYGVKTKQI
RDRVLSLFSHLKIAEY


Conceptual translation

MVNDTTHHYISFFYLVGIPGFENFHYLISIPVCLLFVLTLLGNSIVIATIKLEPSLHQPM
YFFLCMLAMNDILLTCSTSLKMLGIFWFNEHWIEFDVCLTQMYFIHTLCIFESAILVAMA
FDRFVAICIPLHYATILTTAMVIKLGVVGLSRALLMVLPCPLLIKRLPYYTGYIIPHTYC
EHMAVVKLASANTFINRAYGISAALSVITLDVWLIAASYIKILQAVFRLSSQNARSKALG
TCAAHVCTILAFYTPALFSFLTHRIGKNVPPSVHIILASMYLLVPPTVNPLVYGVKTKQI
RDRVLSLFSHLKIAEY