Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52ae8 Olfactory Receptor

Gene Symbol Or52ae8
Organism Mouse
Family 52
Subfamily ae
Pseudo No
Location chr7:103,639,000-103,640,000 (-)
Aliases Olfr622

Sequence information


Nucleotide sequence

MVGNITHQQIASFFLVGIPGLENVHCWIGISVCLLFVLTLLGNSIVIATIKLEPSLHQPM
YFFLCMLAMNDMCLSSSAALKMLGIFWFDAHWINFDACLTQMYFIHTLCIMESAILVAMA
FDRFVAICIPLHYASILTTSMVIKLGLVGLMRCVLMVLPCPILIKRLPYYTKYVIPHTYC
EHMAVVKLASANTLINRAYGISVALSVITVDLGLIATSYVKILQSVFRLSSQNARSKALG
TCAAHVCTILVSYIPALFSFLSHRIGKKVPPSVHIIFASMYLLVPSAVNPVVYGVKTKQI
RDRVIDLFFTHKKFSEK


Conceptual translation

MVGNITHQQIASFFLVGIPGLENVHCWIGISVCLLFVLTLLGNSIVIATIKLEPSIHTFQ
GIESGILFAMAMDRYVAICYPLRHASIFTQRLLTQIGVGVTLRAALFVAPCLFLIKCRLK
FYWTTVVSHSYCEHMAIVKLAAEDVHVNKIYGLFVAFSILGLDIIFITLSYIRIFITVFK
LPQKEARLKAFNTCVAHICVFLEFYLLAFFSFFTHRFGYHVPSYIHILLSNLYLLVPPLL
NPIVYGVKTKQIRDQVSKILYCNYSY