Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52ae8b Olfactory Receptor

Gene Symbol Or52ae8b
Organism Rat
Family 52
Subfamily ae
Pseudo No
Location chr1:168,819,000-168,820,000 (-)
Aliases Olr121

Sequence information


Nucleotide sequence

ATGGCAGGAAATGCTACGTGTCAACACATTGCATCTTTCTTCCTGGTCGGTATTCCTGGA
TTGGAAAATGTTCACTGCTGGATCGGCATCCCTGTCTGTCTCCTGTTTGTCCTGACCCTG
CTGGGGAACAGCATAATCATTGCTACTGTCAAGTTAGAGCCAAGTCTCCACCAGCCTATG
TATTTCTTCCTTTGCATGCTGGCATCGAATGACATGTGTCTTGCCTCTTCTGCAGCTCTG
AAGATGCTTGCCATCTTCTGGTTTGATGCACATTGGATCAACTTTGATGCCTGTCTAACT
CAAATGTATTTTATCCACACTCTGTGCATCATGGAATCAGCCATCCTAGTAGCCATGGCA
TTTGATCGCTTTGTGGCCATTTGTGTCCCTCTTCATTATGCATCAATCCTGACAACATCT
ATAGTGACTAAACTAGGTCTAGTTGGCCTGATAAGAGGTATGCTCATGGTTTTGCCATGT
CCTGTTCTCATTAAGAGGCTGCCTTACTATACACAATATGTCATCCCTCATGCCTACTGT
GAGCACATGGCTGTGGTGAAATTGGCAAGTGGCAACACTCTCATTAACAGAGCATATGGA
ATCTCTGTGGTTCTTTCGGTTATTATAGTGGATATAGGAATGATAGGGACATCCTATGTA
AAAATCCTCCAGTCAGTGTTTTGGCTCTCTTCCCAGAATGCATGCTCTAAAGCCCTGGGT
ACTTGTGCTGCTCATGTCTGCACTATCCTTGCTTCCTATACGCCTGCATTGTTTAGCTTC
CTAACTCACCGCATTGGCAGGAATGTACCTCCAAGTGTTCACATCTGTATTGCCAGTGTG
TACCTTTTAGTACCTTCTGCAGTTAATCCGGTAGTGTATGGTGTCAAGACCAAACAGATT
CGTGATAGAGTGATAGATCTTTTCTTTACACACAAGAAGTTCCCTGAAAAG


Conceptual translation

MAGNATCQHIASFFLVGIPGLENVHCWIGIPVCLLFVLTLLGNSIIIATVKLEPSLHQPM
YFFLCMLASNDMCLASSAALKMLAIFWFDAHWINFDACLTQMYFIHTLCIMESAILVAMA
FDRFVAICVPLHYASILTTSIVTKLGLVGLIRGMLMVLPCPVLIKRLPYYTQYVIPHAYC
EHMAVVKLASGNTLINRAYGISVVLSVIIVDIGMIGTSYVKILQSVFWLSSQNACSKALG
TCAAHVCTILASYTPALFSFLTHRIGRNVPPSVHICIASVYLLVPSAVNPVVYGVKTKQI
RDRVIDLFFTHKKFPEK