Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52ae9 Olfactory Receptor

Gene Symbol Or52ae9
Organism Mouse
Family 52
Subfamily ae
Pseudo No
Location chr7:103,740,000-103,741,000 (-)
Aliases Olfr629

Sequence information


Nucleotide sequence

MAGNATHHIASFFLVGIPGLENFHCWIGIPVCLLFALTLLGNSIILTTVKLEPSLHQPMY
FFLCMLAMNDMCLTCSTALKMLGIFWFDEHWINFDACLTQMFFIHTLCIMESAILVAMAF
DRFVAICIPLHYTSILTTPMVIKIGLVGLSRAILMIMPCPLLIKRLLYYTKYVIHHAYCE
HMAVVKMASGNTQVNRIYGILVALSVTIFDLGLIVTSYIKILQAVFRLSSQNARSKALGT
CVAHVCTILAFYTPALFSFLTHRFGKNVPASIHIIFAILYLLVSPTVNPLVYGAKTKQIR
DRVVSLLFSQKQKF


Conceptual translation

MAGNATHHIASFFLVGIPGLENFHCWIGIPVCLLFALTLLGNSIILTTVKLEPSLHQPMY
FFLCMLAMNDMCLTCSTALKMLGIFWFDEHWINFDACLTQMFFIHTLCIMESAILVAMAF
DRFVAICIPLHYTSILTTPMVIKIGLVGLSRAILMIMPCPLLIKRLLYYTKYVIHHAYCE
HMAVVKMASGNTQVNRIYGILVALSVTIFDLGLIVTSYIKILQAVFRLSSQNARSKALGT
CVAHVCTILAFYTPALFSFLTHRFGKNVPASIHIIFAILYLLVSPTVNPLVYGAKTKQIR
DRVVSLLFSQKQKF