Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52b1 Olfactory Receptor

Gene Symbol Or52b1
Organism Rat
Family 52
Subfamily b
Pseudo No
Location chr1:170,174,000-170,175,000 (-)
Aliases Olr201

Sequence information


Nucleotide sequence

ATGTTTGCTCACCTCCTACCAGAGCTCACAGCTGGCTCTTCTTCCTACTGTCTCTCCATT
ATTTTTAGTCTTCACAGGGAGAATTCAAAAGAAAGCATGCTTGGAGCTAACTTTACCATC
ATCCATCCAGCTGTGTTCATCTTACTTGGAATCCCAGGGCTGGAGCAGTACCACACCTGG
CTTGCTATCCCCTTTTGTCTCATGTACATTGCTGCAGTCTTGGGAAATGGAGCCCTCATC
CTTGTCCCGAGTGAACACACCCTCCACGAGCCCATGTATGTCTTTCTATCCATGCTGGCA
GGCACGGACATTCTCCTGTCAACCAGCACTGTGCCTAAGGCCTTGGCTATCTTTTGGTTC
CATGCTGGGGAGATCCCCTTTGATGCCTGCATTGCTCAGATGTTTTTCATTCATGTTGCT
TTTGTGGCCGAGTCGGGAATCCTTCTGGCCATGGCATTTGACCGCTATGTGGCAATTTGT
ACTCCTCTGAGATACTCAGCTGTCTTAACACCTATGACAATTGGAAAAATGACCCTGGCC
ATCTGGGGACGGAGCATTGGAACCATTTTCCCTATTGTATTCCTGCTGAAGAGACTGTCA
TACTGCAGGACCAATGTCATCCCACACTCATACTGTGAGCATATTGGTGTAGCCAGATTG
GCCTGTGCTGACATCACTGTCAATATCTGGTATGGCTTCTCAGTGCCAATGGCTTCAGTT
TTGGTAGATGTTGCCCTCATTGGTATTTCTTATACTTTGATCCTCCAGGCTGTGTTTAGA
CTTCCTTCTCAGGATGCCAGGCACAAGGCCCTCAACACCTGTGGGTCTCACATTGGAGTC
ATTCTCCTCTTCTTCATACCATCATTTTTTACTTTTCTTACTCATCGCTTTGGCAAGAAC
ATCCCCCACCATGTGCACATTCTTCTGGCAAATCTCTATGTGTTAGTCCCCCCCATGCTT
AACCCTATTATCTATGGTGCTAAGACCAAGCAAATTAGGGACAGCATGACTCACATGTTA
TCTGTTATGTGGAAGTCT


Conceptual translation

MFAHLLPELTAGSSSYCLSIIFSLHRENSKESMLGANFTIIHPAVFILLGIPGLEQYHTW
LAIPFCLMYIAAVLGNGALILVPSEHTLHEPMYVFLSMLAGTDILLSTSTVPKALAIFWF
HAGEIPFDACIAQMFFIHVAFVAESGILLAMAFDRYVAICTPLRYSAVLTPMTIGKMTLA
IWGRSIGTIFPIVFLLKRLSYCRTNVIPHSYCEHIGVARLACADITVNIWYGFSVPMASV
LVDVALIGISYTLILQAVFRLPSQDARHKALNTCGSHIGVILLFFIPSFFTFLTHRFGKN
IPHHVHILLANLYVLVPPMLNPIIYGAKTKQIRDSMTHMLSVMWKS