Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52b2 Olfactory Receptor

Gene Symbol Or52b2
Organism Mouse
Family 52
Subfamily b
Pseudo No
Location chr7:105,337,000-105,338,000 (-)
Aliases Olfr691

Sequence information


Nucleotide sequence

MIHSNITPIHPAFFVLVGIPGLEAYHTWLSIPLCLMYVTAVLGNSILIMVIITERNLHEP
MYFFLSMLAITDILLSTTTVPKALTIFWLHAHNIAFDACVTQVFFVHTMFVGESAILLAM
AFDRFIAICAPLRYATVLTWSTVGRIALAIVIRSICIIFPVIFLLKRLPFCRTNIVPHSY
CEHIGVARLACADITVNIWYGFSVPIVMVIVDVILIAVSYSLILRAVFRLPSQDARHKAL
STCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQ
IREGVVHWFLDIKTLCCSSPLG


Conceptual translation

MIHSNITPIHPAFFVLVGIPGLEAYHTWLSIPLCLMYVTAVLGNSILIMVIITERNLHEP
MYFFLSMLAITDILLSTTTVPKALTIFWLHAHNIAFDACVTQVFFVHTMFVGESAILLAM
AFDRFIAICAPLRYATVLTWSTVGRIALAIVIRSICIIFPVIFLLKRLPFCRTNIVPHSY
CEHIGVARLACADITVNIWYGFSVPIVMVIVDVILIAVSYSLILRAVFRLPSQDARHKAL
STCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQ
IREGVVHWFLDIKTLCCSSPLG