Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52b2 Olfactory Receptor

Gene Symbol Or52b2
Organism Rat
Family 52
Subfamily b
Pseudo No
Location chr1:170,186,000-170,186,000 (-)
Aliases Olr202

Sequence information


Nucleotide sequence

ATGATTCACAGCAATATCAGCATCATCCACCCTGCAGTTTTTGTGCTACTTGGCATCCCT
GGGTTGGAGACTTATCACATCTGGCTGTCTATACCCCTGTGCCTCATGTATGTCACTGCA
GTCCTCGGAAACAGCATCTTGATAATGGTCATCATCACAGAACGGAACCTTCATGAACCC
ATGTATTTTTTCCTCTCCATGTTGGCCATCACAGACATCTTACTGTCCACCACTACTGTA
CCCAAGGCCCTCGCTATCTTTTGGTTCCATGCCCACAACATTGCCTTTGATGCCTGTGTC
ACCCAAGTCTTCTTTGTGCATACAATGTTTGTGGGGGAGTCAGCCATCTTGTTAGCCATG
GCCTTTGACCGCTTTGTAGCTATCTGTGCCCCACTGAGATATGCAACAGTGCTAACCTGG
CCCACAGTTGGGAGGATGGCTCTAGCCATTGTCATCAGAAGCGTCTGTATTATCTTTCCT
GTGATTTTCTTGCTCAAGCGGCTGCCATTCTGCAGAACCAACATTGTCCCCCATTCCTAC
TGTGAGCACATTGGGGTGGCCCGCTTAGCTTGTGCCGACATCACCGTTAACATTTGGTAC
GGCTTCTCAGTGCCTATCGTCATGGTCATCGTGGATGTGATCCTCATTGCTGTGTCATAC
TCGCTCATCCTCCGAGCGGTGTTTCGTTTGCCCTCCCAGGATGCTCGGCACAAAGCTCTC
AGCACCTGTGGCTCGCATCTCTGCGTCATCCTCATGTTTTACGTTCCGTCCTTCTTTACT
TTACTGACCCACCGCTTTGGGAGAAACATTCCCCGACATGTGCATATCCTGCTGGCCAAT
CTTTATGTGGTGGTGCCTCCAATGCTGAACCCCATTGTCTACGGAGTGAAGACTAAGCAG
ATCCGGGAGGGTGTGGTCCACTGGTTCTTGGACATTAAGACTCAGTGTTGTTCCTTGCCT
TTGGGA


Conceptual translation

MIHSNISIIHPAVFVLLGIPGLETYHIWLSIPLCLMYVTAVLGNSILIMVIITERNLHEP
MYFFLSMLAITDILLSTTTVPKALAIFWFHAHNIAFDACVTQVFFVHTMFVGESAILLAM
AFDRFVAICAPLRYATVLTWPTVGRMALAIVIRSVCIIFPVIFLLKRLPFCRTNIVPHSY
CEHIGVARLACADITVNIWYGFSVPIVMVIVDVILIAVSYSLILRAVFRLPSQDARHKAL
STCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQ
IREGVVHWFLDIKTQCCSLPLG