Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52b3-ps Olfactory Receptor

Gene Symbol Or52b3-ps
Organism Rat
Family 52
Subfamily b
Pseudo Yes
Location chr1:167,685,000-167,686,000 (+)
Aliases Olr42-ps

Sequence information


Conceptual translation

MATFTHTGTSHSAFILLGIPGLEEQHLWISLPFFISYLVALCGNSILILVILTEHSLHEP
MYLFLCMLAAADLILSTTTVPKALAIFWFHAGAISLDGCVTQIFFIHATFIAESGILLAM
AFDCYVAICDPLHYSTVLSHMVI\GSAWLWS*EVSV*SSQMCSFLPFCHSNVLPHTYCE
HMAVARFACADIRVNVWYSLSVLLSTVVLDALLILVSYGLILHTVFRLPSGGARQKALGT
CGSHLGVISMFYLPGIFTIITQRFGHHVPLHTHILLANVCMLAPPMLNPIIYGIKTRQIR
ERVLSSLSSQWKLC