Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52b4 Olfactory Receptor

Gene Symbol Or52b4
Organism Mouse
Family 52
Subfamily b
Pseudo No
Location chr7:102,535,000-102,536,000 (+)
Aliases Olfr547

Sequence information


Nucleotide sequence

MTTLNYTVVSHTVFHLLGIPGLEDQHMWISIPFFISYITALLGNSLLIFIILTRPSLHGP
MYLFLCMLVGADIVLSTSTVPQALSIFWFHAGEISLDRCITQLFFIHSTFISESGILLVM
AFDRYIAICYPLRYTTVLTNSLIGKIRVGIFLRSYGTIFPIIFLLKRLTFCKNNIIPHTY
CEHIGLAKYACNSIRVNIWYGFSVLILTVVLDVVLIFVSYVLILRAVFRMPSQDARHKAL
NTCGSHVCIIILFYGPGIFTTLTQRFGRHIPPHIHILLANVCILAPPMLNPIIYGIKTKQ
IQEQMVHVLFT


Conceptual translation

MTTLNYTVVSHTVFHLLGIPGLEDQHMWISIPFFISYITALLGNSLLIFIILTRPSLHGP
MYLFLCMLVGADIVLSTSTVPQALSIFWFHAGEISLDRCITQLFFIHSTFISESGILLVM
AFDRYIAICYPLRYTTVLTNSLIGKIRVGIFLRSYGTIFPIIFLLKRLTFCKNNIIPHTY
CEHIGLAKYACNSIRVNIWYGFSVLILTVVLDVVLIFVSYVLILRAVFRMPSQDARHKAL
NTCGSHVCIIILFYGPGIFTTLTQRFGRHIPPHIHILLANVCILAPPMLNPIIYGIKTKQ
IQEQMVHVLFT