Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52b4 Olfactory Receptor

Gene Symbol Or52b4
Organism Rat
Family 52
Subfamily b
Pseudo No
Location chr1:167,660,000-167,661,000 (+)
Aliases Olr41

Sequence information


Nucleotide sequence

ATGACTACTTTAAACCACACTGTTGTAAGTCACACGGTCTTCCGCTTGCTGGGCGTCCCT
GGCCTAGAGGACCAGCACATGTGGATTTCCATCCCCTTCTTCATTTCCTATGTCACTGCC
CTGCTTGGGAACAGCCTGCTCATCTTTGTCCTCACAAGGCCTAGTCTCCATGGACCCATG
TACTTCTTCCTCTGCATGCTGGCGGGGGCAGACATCGTGCTGTCCACATCCACAGTTCCC
CAGGCCTTGTCCATCTTCTGGTTCCACGCTGGGGAGATCTCCCTGGATCGCTGCATCACT
CAGCTCTTCTTCATGTACTCCACCTTCATCGCTGAGTCTGGGATCTTGCTGGTGATGGCC
TTTGACCGCTTCATTGCCATTTGCTACCCGCTGAGGTACAGCACTATTTTCACAATCTCC
CTAATTGGAAAAATTGGAATGGCCATCTTTCTGAGAAGCTTTGTTACAATTTTCCCCGTA
ATATTTCTTGTGAAAAGATTAACTTTCTGCAAAAATAAAATTATTCCACACACCTACTGT
GAACACATAGGCCTGGCTAAATATGCTTGTAACAATATCCGAGTAAACTTTTGGTATGGA
ATTTTTGTTTTAATGTCAACAATAACTTTAGATGTTGTGTTAATTTTTGTTTCCTATGTG
CTGATCCTCCGTTCCATTTTCCGAATGCCTTCCCAGGATGCTCGCCACAAAACTCTCAAC
ACATGTGGCTCCCATGTCTGCGTCATTATCCTCTTTTATGGCCCTGGGATCTTCACAACA
CTTACACAGAGGTTTGGGCGCCACATCCCACCTCACATCCACATCCTGTTGGCTAATGTC
TGCATTCTGGTTCTACCTATGCTGAACCCTATCATTTACGGAATCAAGAGCAAGCAAATC
CAGGAGCAGATTGTTCATGTCTTGTTTACAAACTATAAG


Conceptual translation

MTTLNHTVVSHTVFRLLGVPGLEDQHMWISIPFFISYVTALLGNSLLIFVLTRPSLHGPM
YFFLCMLAGADIVLSTSTVPQALSIFWFHAGEISLDRCITQLFFMYSTFIAESGILLVMA
FDRFIAICYPLRYSTIFTISLIGKIGMAIFLRSFVTIFPVIFLVKRLTFCKNKIIPHTYC
EHIGLAKYACNNIRVNFWYGIFVLMSTITLDVVLIFVSYVLILRSIFRMPSQDARHKTLN
TCGSHVCVIILFYGPGIFTTLTQRFGRHIPPHIHILLANVCILVLPMLNPIIYGIKSKQI
QEQIVHVLFTNYK