Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52d1b-ps Olfactory Receptor

Gene Symbol Or52d1b-ps
Organism Rat
Family 52
Subfamily d
Pseudo Yes
Location chr1:169,292,000-169,293,000 (+)
Aliases Olr147-ps

Sequence information


Nucleotide sequence

TACAGCCACAGGACTATTGTCTCCCCTTTCATCTTTTTGCTGAGGCGACTGCCCTACTGT
AGTCACCATGTCATGGCTCACACATACTGTGAGCATATGGGCACGGCTAGGCTTGCCTGT
GCCAACATCACTGTCAACATTGTCTATGGGCTGACTGTGGCTCTGCTGGCCATGGGCCTG
GATTCCATCCTCATTGCCATCTCCTATGGCTTCATCCTCCGGGCTGTCTTCCGTCTCCCA
TCCCGTGACGCTCAACACAAGGCTCTGAGTACCTGTGGATCTCACCTTGGTGTCATCTTG
GTTTTCTACACCCCTGCTTTCTTCTCCTTCCTCACCCACCATTTTGGTCACAACTGAGTT
CCCAAGAATGTGCCCATCTTCCTGGTTAGCTGCTATGTGCTGGTGCCTCTCATGCTCAAT
CCCATCATCTACAGAGCAAGAACCAAGAAGATTTGAAGTCTGCTTCTAAAACTGCTTCAC
TTAGAGAAAGGCTCAGTA


Conceptual translation

MSYSNVSDHLPDTLILTGIPELEFAHLGIAIPFCVMYLIALLGNAALILIIGTESALHAP
MYLFLCLLSLTDLALSSTTVPKTLSILWLHVGEISSGECLAQMLCIHSIYALESSVLLAM
TFD*YVATCNPLRYTVILN/YSHRTIVSPFIFLLRRLPYCSHHVMAHTYCEHMGTARLA
CANITVNIVYGLTVALLAMGLDSILIAISYGFILRAVFRLPSRDAQHKALSTCGSHLGVI
LVFYTPAFFSFLTHHFGHN*VPKNVPIFLVSCYVLVPLMLNPIIYRARTKKI*SLLLKLL
HLEKGSV