Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52d3 Olfactory Receptor

Gene Symbol Or52d3
Organism Mouse
Family 52
Subfamily d
Pseudo No
Location chr7:104,580,000-104,581,000 (+)
Aliases Olfr653

Sequence information


Nucleotide sequence

MMLSAAIPNETAFHPPTFVLLGIPGMQDQHVWIAIPFCSMYILALVGNGTILYIIITDRA
LHEPMYLFLCLLSITDLVLCSTTLPKMLAIFWLRSHVISYHGCLTQMFFVHAVFATESAV
LLAMAFDRYVAICRPLHYTSILNAVVIGKIGLACVTRGLLFVFPFVILIERLPFCGHHII
PHTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDVVLIATSYILILQAVLRLPSKDAQ
FRAFSTCGAHICVILVFYIPAFFSFFTHRFGHHVPPQVHIILANLYLLVPPVLNPLVYGI
NTKQIRLRILDFFVKRR


Conceptual translation

MMLSAAIPNETAFHPPTFVLLGIPGMQDQHVWIAIPFCSMYILALVGNGTILYIIITDRA
LHEPMYLFLCLLSITDLVLCSTTLPKMLAIFWLRSHVISYHGCLTQMFFVHAVFATESAV
LLAMAFDRYVAICRPLHYTSILNAVVIGKIGLACVTRGLLFVFPFVILIERLPFCGHHII
PHTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDVVLIATSYILILQAVLRLPSKDAQ
FRAFSTCGAHICVILVFYIPAFFSFFTHRFGHHVPPQVHIILANLYLLVPPVLNPLVYGI
NTKQIRLRILDFFVKRR