Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52d3 Olfactory Receptor

Gene Symbol Or52d3
Organism Rat
Family 52
Subfamily d
Pseudo No
Location chr1:169,576,000-169,577,000 (+)
Aliases Olr154

Sequence information


Nucleotide sequence

ATGATGCTTTCTGCCTCTATCCCCAATGGAACTGCCTTCCACCCTTCCACATTTGTTTTG
CTCGGGATCCCTGGGATGCAGGACCAGCATGTTTGGATTGCTATTCCCTTCTGCTCCATG
TACATCCTTGCTCTGGTCGGAAATGGTACCATCCTCTACATCATTATAACAGACAGAGCT
CTCCATGAGCCCATGTACCTCTTCTTGTGCCTGCTTTCTATTACTGATCTGGTCCTCTGT
TCAACAACATTGCCTAAAATGCTGGCTATCTTCTGGCTCAGATCCCATATTATTTCCTAC
CATGGCTGCCTCACCCAGATGTTTTTTGTTCATGCAGTTTTTGCCACTGAGTCAGCTGTT
CTGCTGGCCATGGCTTTTGATCGCTATGTGGCTATCTGCAGACCACTTCACTATACATCC
ATCCTCAATGCTGTAGTAATTGGGAAGATTGGTCTGGCATGTGTGACTCGTGGCCTTCTC
TTTGTCTTTCCTTTTGTCATTCTCATTGAACGTTTACCCTTCTGTGGCCATCATATCATC
CCTCACACTTATTGTGAGCACATGGGCATAGCCAAGCTGGCCTGTGCCAGCATTAAGCCT
AACACCATCTATGGTCTTACTGTAGCACTTTCAGTCACTGGCATGGATGTGGTCCTCATT
GCTACTTCCTATATCCTGATTCTGCAGGCCGTGCTGCGACTGCCCTCAAAGGATGCCCAG
TTCCGAGCATTCAGCACGTGTGGAGCCCACATTTGTGTAATTCTTGTCTTCTACATCCCT
GCATTCTTTTCATTTTTCACTCACCGCTTTGGTCACCATGTACCCCCTCAGGTACACATC
ATACTTGCAAATCTCTACCTCCTTGTGCCTCCTGTTCTCAACCCCCTAGTCTATGGCATC
AATACCAAACAAATCCGCCTGAGAATACTTGACTTTTTTGTAAAGAGAAGG


Conceptual translation

MMLSASIPNGTAFHPSTFVLLGIPGMQDQHVWIAIPFCSMYILALVGNGTILYIIITDRA
LHEPMYLFLCLLSITDLVLCSTTLPKMLAIFWLRSHIISYHGCLTQMFFVHAVFATESAV
LLAMAFDRYVAICRPLHYTSILNAVVIGKIGLACVTRGLLFVFPFVILIERLPFCGHHII
PHTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDVVLIATSYILILQAVLRLPSKDAQ
FRAFSTCGAHICVILVFYIPAFFSFFTHRFGHHVPPQVHIILANLYLLVPPVLNPLVYGI
NTKQIRLRILDFFVKRR