Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e15 Olfactory Receptor

Gene Symbol Or52e15
Organism Mouse
Family 52
Subfamily e
Pseudo No
Location chr7:104,996,000-104,997,000 (-)
Aliases Olfr672

Sequence information


Nucleotide sequence

MSPGNSSWIHPSSFLLLGIPGLEELQFWLGLPFGTVYLIAVLGNVIILFVIYLEHSLHQP
MFYLLAILAVTDLGLSTATVPRALGIFWFGFHKIAFRDCVAQMFFIHLFTGIETFMLVAM
AFDRYIAICNPLRYNTILTNRTICIIVGVGLFKNFILVFPLIFLILRLSFCGHNIIPHTY
CEHMGIARLACVSIKVNVLFGLILISMILLDVVLIALSYAKILHAVFKLPSWEARLKALN
TCGSHVCVILAFFTPAFFSFLTHRFGHNIPRYIHILLANLYVIIPPALNPLIYGVRTKQI
RDRVVIFFCKEV


Conceptual translation

MSPGNSSWIHPSSFLLLGIPGLEELQFWLGLPFGTVYLIAVLGNVIILFVIYLEHSLHQP
MFYLLAILAVTDLGLSTATVPRALGIFWFGFHKIAFRDCVAQMFFIHLFTGIETFMLVAM
AFDRYIAICNPLRYNTILTNRTICIIVGVGLFKNFILVFPLIFLILRLSFCGHNIIPHTY
CEHMGIARLACVSIKVNVLFGLILISMILLDVVLIALSYAKILHAVFKLPSWEARLKALN
TCGSHVCVILAFFTPAFFSFLTHRFGHNIPRYIHILLANLYVIIPPALNPLIYGVRTKQI
RDRVVIFFCKEV