Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52e15b-ps Olfactory Receptor

Gene Symbol Or52e15b-ps
Organism Rat
Family 52
Subfamily e
Pseudo Yes
Location chr1:169881516-169882454 (-)
Aliases Olr181

Sequence information


Nucleotide sequence

ATGTCACCAGGCAACAGCTCATGGATTCACCCTTCATCCTTCCTGCTCTTGGGAATCCCA
GGACTGGAAGAGTCACAGTTCTGGCTTGGTTTTCCATTTGGAACAGTCTATCTTACTGCT
GTCCTAGGGAATGTCATCCTTCTCTTTGTGGTCCATCTCGAGCACAGTCTTCATCAGCCC
ATGTTCTACTTATTGGCCATGCTGGCTCTGACTGACTTGGGCCTGTCCACGGCAACTGTT
CCCAGAGCACTTGGCATATTCTGGTTTGGCTTCCATAAGATTGCCTTTAGGGACTGTATA
GCTCAAATGTTTTTCATCCATCTGTTCACAGGCATTGAAACATTCATGCTTGTAGCTATG
GCCTTTGATCGCTACATTGCCATCTGTAACCCTCTCCGATACAACACTATCCTCACCAAC
AGAGTGATCTGTATTATTGCTGGCATTGGACTATTCAAAAATTTCATTTTGATTTTTCCA
CTTATATTTCTTATTCTAAGGCTTTCATTCTGTGGACACAATGTCATACCACACACATAT
TGTGAGCACATGGGCATTGCCCGACTGGCATGTGTCAGCATCAAGGTTAATGTACTATTT
GGATTATTACTCATATCTATGATACTTCTGGATGTTATTTTGATTGCTCTGTCCTATGTG
AAAATTCTTCATGCCGTATTCAAACTTCCATCCTGGGAAGCCAGGCTCAAAGCTCTAAAT
ACCTGTGGTTCTCATGTGTGTGTGATATTGGCTTTCTTCACTCCAGCCTTTTTTTCCTTC
TTGACTCATCGATTTGGACACAACATTCCACAGTATATCCATATCCTCCTTGCTAACTTG
TATGTGATGATTCCACCTGCTCTTAACCCTCTTATTTATGGGGTGAGAACCAAACAGATT
CGAGATCGTGTAGTGATATTTTTTTGTAAGGGAGTTTGA


Conceptual translation

MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLTAVLGNVILLFVVHLEHSLHQP
MFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFTGIETFMLVAM
AFDRYIAICNPLRYNTILTNRVICII/WHWTIQKFHFDFST\FLILRLSFCGHNVIPH
TYCEHMGIARLACVSIKVNVLFGLLLISMILLDVILIALSYVKILHAVFKLPSWEARLKA
LNTCGSHVCVILAFFTPAFFSFLTHRFGHNIPQYIHILLANLYVMIPPALNPLIYGVRTK
QIRDRVVIFFCKGV