Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e18 Olfactory Receptor

Gene Symbol Or52e18
Organism Mouse
Family 52
Subfamily e
Pseudo No
Location chr7:104959795-104960895 (-)
Aliases Olfr670, GA_x5J8B7W6B6J-141796-141659, MOR32-8

Sequence information


Nucleotide sequence

ATGTTCATGTACTTAAATATCACTTTTTTAAAAAAGGGCCTTTATCATAATAGGTGTGTT
TGTGTGCATGTGTATGTGTTAACATATATGGTCGATACATGTATATACACATTTCAAATG
GTTGTGGGTTATTTTTTTCTTTCAGAGTTCAAGGACAGAGAGGGAATGTCCAGTTCAAAT
GGAACTGAATTCCACCCCTCTTTTTTCCTCTTGCTGGGAGTTCCAGGCCTTGAAAAGTTG
CATGTGTGGATTGGTTTTCCTTTTTGCTTTGTGTATTTGATTGCCCTGGTTGGGAACATC
ATTATCTTGTTTGTGATCAAGAGTGAACACAGTCTTCATCAACCCATGTTTTACTTCTTA
GCAATGCTGGGCTCCATTGATCTAGGCCTATCCACATCCACAATTCCCAAGATGCTGGGC
ATCTTCTGGTTTAATTTACGGGAGATCAGCTTTGGGGGATGTGTGACCCAGATGTTCTTC
ATCCACATATTCACTGCAATGGAGACTGTAGTGCTGGTTGCCATGGCCTTTGACCGCTAT
GTTGCCATCTGCAATCCTCTGCGGTACAGTCAGATTCTCACCAACAGAACAATAGGACTC
ATCCTGGTGGTGGTGTTTGGAGTAAATTTCATTTTGCTCATTCCTCTGGTATTTCTCATA
TTGAGGCTTCCTTTCTGTGGTCACCATATAATTCCTCACACTTACTGTGAACACATGGGG
ATTGCTCGTCTGGCCTGTGCCAACATAAAGGTAAACATGATATTTGGGTTGATACTTATA
TCAATGGTGCTTGCCGATGTGCTTCTAATTGCCATCTCCTATATGCGGATACTACGAGCG
GTCTTCTGCCTTCCATCCCGGGATGCCAGGCTCAAAGCACTTAACACATGTGGCTCCCAC
ATCTGTGTCATCCTGGCCTTCTTCACTCCAGCTTTTTTCTCATTCATGACACATAGGTTT
GGCAGGAATGTTCCTGCATACATTCATATTCTCCTGGCTAATCTATATGTTGTTGTTCCC
CCAGCCCTGAATCCTGTCATCTATGGGGTGAGGACTAAGCAGATTCGGGATCAGGTTTTA
AGCATCTTTTGGAAGAAAACA


Conceptual translation

MFMYLNITFLKKGLYHNRCVCVHVYVLTYMVDTCIYTFQMVVGYFFLSEFKDREGMSSSN
GTEFHPSFFLLLGVPGLEKLHVWIGFPFCFVYLIALVGNIIILFVIKSEHSLHQPMFYFL
AMLGSIDLGLSTSTIPKMLGIFWFNLREISFGGCVTQMFFIHIFTAMETVVLVAMAFDRY
VAICNPLRYSQILTNRTIGLILVVVFGVNFILLIPLVFLILRLPFCGHHIIPHTYCEHMG
IARLACANIKVNMIFGLILISMVLADVLLIAISYMRILRAVFCLPSRDARLKALNTCGSH
ICVILAFFTPAFFSFMTHRFGRNVPAYIHILLANLYVVVPPALNPVIYGVRTKQIRDQVL
SIFWKKT