Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52e19 Olfactory Receptor

Gene Symbol Or52e19
Organism Rat
Family 52
Subfamily e
Pseudo No
Location chr1:168,391,000-168,392,000 (+)
Aliases Olr87

Sequence information


Nucleotide sequence

ATGTCCTCTATTAATGAAACTGCTTCACACCCCTCTCTCTTCTATCTGCTGGGCATTCCT
GGGCTGGAAGCTTTCCACGTCTGGATAGCCTTCCCTTTCTTCGTTGTTTATCTGATAGCA
CTTGCGGGAAATTTCACAATCCTTTGTGTGATCAAGAATGAGCAGAGTCTCCACCAGCCC
ATGTTCTACTTTCTTGCCCTCCTCTCTTTCATTGATCTTGGCCTCTCTACTTCCACCATT
CCCAAGATGCTGGGTATCTTCTGGTTCAACCTCAGGGAGATAAGCTTTGAAGGCTGCCTC
ATCCAAATGTTCTTCATCCACACTTACACAGGCATGGAATCTGTTGTACTCCTGGCCATG
GCAATTGACCGTTTTGTTGCCATCTGTTACCCACTTAGGTATACCTCTATCCTCACCAAC
AAGGTGGTAGCTGTCATGGCATCTATTGTGATAGGGAGACCTGTCCTTCTTGTCATCCCT
TTTTGTCCTCTCCTAAAACGCCTGCCCTTTTGTGGACACTACATTATTCCTCACACCTAC
TGTGAGCATATGGGGATAGCTCGTCTAGCCTGCGCCAACATAAGGATAAACATCATCTAT
GGCTTATTCACCATTGCTGCTCTGATCTTTGATTTAATCCTCATTGCTCTCTCCTATGCT
AGGATCCTACAGGCTGTTTTCCGCCTTCCTTCAAGGGATGCCAGACACAAAGCCCTTAGC
ACATGTGGTTCCCACGTCTGTGTCATCTTAGCCTTTTATACACCAGCATTTTTCTCTTTT
ATGACTCATAGGTTTGGTAGAAATGTACCTCGTTACATTCACATTCTCTTGGCCAATCTC
TATGTGGTTGTCCCTCCTTGTTTAAATCCAGTCATTTATGGAGTGAGGACAAAACAAATT
AGGGAGGGAGTCATAAAAATACTTGTAAAGAAAGAG


Conceptual translation

MSSINETASHPSLFYLLGIPGLEAFHVWIAFPFFVVYLIALAGNFTILCVIKNEQSLHQP
MFYFLALLSFIDLGLSTSTIPKMLGIFWFNLREISFEGCLIQMFFIHTYTGMESVVLLAM
AIDRFVAICYPLRYTSILTNKVVAVMASIVIGRPVLLVIPFCPLLKRLPFCGHYIIPHTY
CEHMGIARLACANIRINIIYGLFTIAALIFDLILIALSYARILQAVFRLPSRDARHKALS
TCGSHVCVILAFYTPAFFSFMTHRFGRNVPRYIHILLANLYVVVPPCLNPVIYGVRTKQI
REGVIKILVKKE