Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e2 Olfactory Receptor

Gene Symbol Or52e2
Organism Mouse
Family 52
Subfamily e
Pseudo No
Location chr7:103,155,000-103,156,000 (-)
Aliases Olfr589

Sequence information


Nucleotide sequence

MILPNDTQFHPSTFLLLGIPGLESLHIWIGFPFCVVYMIALLGNLTILFVIKTESSLHQP
MFYFLAMLATIDLGLSTATIPKMLGIFWINLREILFEDCLIQMFFIHKFTLMESTVLLAM
AYDHYVAICIPLRYSTILTNKVVSMIGIAVLVRAIIFVIPFIFLILRLPFCGHHIIPHTY
CEHMGLARLSCASVKANVIYGLCAICNLLFDIVAIVLSYIQILRVVFHLPSREARLKSLN
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YDRVKKILLQVRGKEKE


Conceptual translation

MILPNDTQFHPSTFLLLGIPGLESLHIWIGFPFCVVYMIALLGNLTILFVIKTESSLHQP
MFYFLAMLATIDLGLSTATIPKMLGIFWINLREILFEDCLIQMFFIHKFTLMESTVLLAM
AYDHYVAICIPLRYSTILTNKVVSMIGIAVLVRAIIFVIPFIFLILRLPFCGHHIIPHTY
CEHMGLARLSCASVKANVIYGLCAICNLLFDIVAIVLSYIQILRVVFHLPSREARLKSLN
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YDRVKKILLQVRGKEKE