Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e5 Olfactory Receptor

Gene Symbol Or52e5
Organism Mouse
Family 52
Subfamily e
Pseudo No
Location chr7:105,069,000-105,070,000 (+)
Aliases Olfr678

Sequence information


Nucleotide sequence

MLHSNKTQFHPSSFLLIGIPGLEELHLWIGFPFFAVYLIAVLGNIIILFVIQTERSLHQP
MFYFLAMLACTDLGLSTATIPKMLGIFWFNLREIAFGACITQMYIIHTCTGLESVVLTIM
AIDRYIAICYPLRYSMILTNKVIAILGIIIIVRTLIFVTPFIFLILRLPFCGVRIIPHTY
CEHMGLAKLACANIKVNVIYGLVAFSVGYIDLSVIGFSYIRILQAVFRLPSWDARLKALS
TCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVLRMLNPKMH


Conceptual translation

MLHSNKTQFHPSSFLLIGIPGLEELHLWIGFPFFAVYLIAVLGNIIILFVIQTERSLHQP
MFYFLAMLACTDLGLSTATIPKMLGIFWFNLREIAFGACITQMYIIHTCTGLESVVLTIM
AIDRYIAICYPLRYSMILTNKVIAILGIIIIVRTLIFVTPFIFLILRLPFCGVRIIPHTY
CEHMGLAKLACANIKVNVIYGLVAFSVGYIDLSVIGFSYIRILQAVFRLPSWDARLKALS
TCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVLRMLNPKMH