Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52e5 Olfactory Receptor

Gene Symbol Or52e5
Organism Rat
Family 52
Subfamily e
Pseudo No
Location chr1:169,919,000-169,920,000 (+)
Aliases Olr186

Sequence information


Nucleotide sequence

ATGCTTCATTCCAACAAGACACAGTTCCACCCTTCCTCCTTCCTCCTGATAGGGATCCCA
GGGCTGGAAGATTTGCACCTTTGGATCGGCTTTCCCTTCTTTGCAGCGTATCTGATAGCC
GTCTTGGGGAACACCATCATCTTATTTGTGATCCAAACTGAACACAGCCTCCACCAACCT
ATGTTCTACTTTCTGGCCATGTTGGCATGCACCGATTTGGGTTTATCCACAGCCACCATC
CCCAAGATGCTGGGCATTTTCTGGTTCAATCTCGGGGAGATTACATTTGGAGCCTGCATC
ACTCAGATGTATACCATCCACCTATGCACCGGCCTGGAATCTGTGGTGCTGACAGTTATG
GCCATAGATCGTTATATTGCTATATGTAACCCACTGAGGTACAGCATGATCCTCACCAAC
AAGGTGATAGCTATTCTGGGTGTAGTCATCATAGTCAGGACTTTGGTGTTTGCCACTCCA
TTTATATTTCTCATCTTTAGGTTGCCTTTCTGTGGTGTCCGAATTGTCCCACATACCTAC
TGTGAACACATGGGTTTGGCAAAGCTAGCTTGTGCTAATATCAGGGTCAATGTTATCTAT
GGATTGGTTGCTTTCTCAGTGGGATACATTGATCTATCTGTGATTGGATTTTCCTACATC
CGGATTCTCCAAGCAGTCTTCCGCCTTCCATCCTGGGATGCTCGGCTTAAGGCACTTAGC
ACATGTGGCTCCCATGTGAGTGTCATGTTGGCCTTTTACCTGCCAGCTCTCTTCTCATTC
ATGACACACCGCTTTGGCCACAACATCCCTCACTATATCCACATACTTCTAGCCAATCTG
TATGTGGTCGTTCCTCCTGCCCTGAACCCTGTTATCTATGGAGTCAGGACAAAACAGATA
AGGGAGAGAGTAGTAAGAATGCTTAACCCTAAGATGCAC


Conceptual translation

MLHSNKTQFHPSSFLLIGIPGLEDLHLWIGFPFFAAYLIAVLGNTIILFVIQTEHSLHQP
MFYFLAMLACTDLGLSTATIPKMLGIFWFNLGEITFGACITQMYTIHLCTGLESVVLTVM
AIDRYIAICNPLRYSMILTNKVIAILGVVIIVRTLVFATPFIFLIFRLPFCGVRIVPHTY
CEHMGLAKLACANIRVNVIYGLVAFSVGYIDLSVIGFSYIRILQAVFRLPSWDARLKALS
TCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVVRMLNPKMH