Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e51-ps Olfactory Receptor

Gene Symbol Or52e51-ps
Organism Mouse
Family 52
Subfamily e
Pseudo Yes
Location chr7:103235686-103236582 (+)
Aliases Olfr595-ps1, MOR32-6P

Sequence information


Nucleotide sequence

GGAATTCCAGGTCTGGAGGACACACATCTATGGATTGGATTTCCTTTTTGTTGTTGTTGT
TGTTGTATATTTGACTGCTCTTCTGGGAAATATTACGATTATTTCTGTGATTCAGACTGA
ACACAGCCTCCACCAGCCCATGTTCTACTTCCTGTCCATTCTGTCATCTATTGTCCTGGG
CTTGTCCACATCCACCATCCCCGAGATGCTTAGAACCTTTTGGCTTAATTTTAAAAAGAT
ATTATTTGATGGCGGTGTTATCCAGATGTTCTTCATCCATCTGTTCATAGGTATGGAGTC
AGCTGTGCTTTTGGCCATGGCTTATGATCGCTATGTGGCCATCTGTAATCCTCTTCACTA
CACACTGGTGCTGACAAACAAGGTAGTATTCATCAATGCTTGCCTTGTCCTCCTGAGACC
CTTAGTCACTGCAATTCCCTTTATTGTGCTCATCCAGAGATTACCCTTCTGTGGACATCA
AGTTATTCTGCATACATACTGTGAGCACATGGGCATTACCCTTCTGCCCTGTGCCAGCAT
CAAGGTGAACATCATCTACGGTTTGTGTGCCATCTCTACCCTGGTTTTTGATATTGTAGC
AATTATTGTCTCCTATATATTCAGGTCCTCCATGCTGTCTCCCACCTACCTTCCAGGGAT
GCTCGACTAAAGGCTCTCAGCACCTGTGGCTCTCATGTCTGTGTCATCCTTTCCTTCTGT
ACACCAGCATTTTTCTCCTTTATGATTAACCAGTTTGAGCGAAATGTTCCCCGATATATC
CATATTCTTCTTGCCAACCTTTATGTTGTCATTCCTCCTGCTCTTAACCCTGTCATTTAT
GGTGTTAGAACTAAGAAAATAAGAGAGAGGGTAGCTATGGCTATCAGAAATAAATTG


Conceptual translation

GIPGLED\IYGLDFLFVVVVVVYLTALLGNITIISVIQTEHSLHQPMFYFLSILSSIVL
GLSTSTIPEMLRTFWLNFKKILFDGGVIQMFFIHLFIGMESAVLLAMAYDRYVAICNPLH
YTLVLTNKVVFINACLVLLRPLVTAIPFIVLIQRLPFCGHQVILHTYCEHMGITLLPCAS
IKVNIIYGLCAISTLVFDIVAIIV/LYIQVLHAVSHLPSRDARLKALSTCGSHVCVILS
FCTPAFFSFMINQFERNVPRYIHILLANLYVVIPPALNPVIYGVRTKKIRERVAMAIRNK
L