Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e53-ps Olfactory Receptor

Gene Symbol Or52e53-ps
Organism Mouse
Family 52
Subfamily e
Pseudo Yes
Location chr7:105006316-105007258 (-)
Aliases Olfr674-ps1, MOR32-7P

Sequence information


Nucleotide sequence

ATGTCACCAGGCAACAGCTCATGGATTCATCCTTCTTCCTTCCTGCTCTTGGGAATCCCA
GGACTGGAAGAGTTGCAGTTCTGGCTTGGTTTGCCATTTGGAACAGCCTATCTTATTGCT
GTCCTAGGGAATGTCATCATTCTCTTTGTAATCTATCTAGAGCACAGCCTTCACCAGCCT
ATGTTCTACTTACTGGCCATACTGTCTGCTACTGACTTGGGTCTGTTTACAGCAACTGTT
CCCAGAGCACTTGGCATATACTGGTTTGGCTTCCATAAGATTGCCTCTAGGAACTGTAGC
TCAAATGTTCTTCATGCATCTGTTTACAGGCATGGAAACATTCATACTTGTGGCTATGGC
CTTTGATTGCTACATTGCCATCTGTAACCCTCTCTGATACAACACTATCCTCACCACCAG
AATGATCTGCATTATTGCTGGAGTTGGACTACTCAGAAATTTCATTTTGGTTTTTCCACT
TATATTTCTCATTCTAAGGCGTTCATTCTGTGAGCATAATATCATACTGCACACATACTG
TGAGCGCATGGGTATTGCTCGACTGGCATGCATCAGCATCAAGGTTAATGTATTATTTGG
ATTAATACTCATATATATGATACTTCTGGATGTTATTTTGAGTGCTCTGTCCTATGTGAA
AATTCTTCATGCTGTATTTAAACTCCCATCCTGGGAAGCCAGACTCAAAGCTCTTAATAC
CTGTGGTTCCCATGTGTGTATGATCTTGGCTTTCTTCACTCCAGCCCTTTTCTCCTTCTT
GGCTCATCGATTTGGGCACAATATTCCACGATATATCCACATCCTCCTTGCTAACTTATA
TATAATCATTCCCCTGGTTCTTAACCCTATTATTTATGGGATGAGAACCAAGCAGATACA
AGATCGTCCAGTGACGATATTGTTTAGCAAGGAAGTTTTACTG


Conceptual translation

MSPGNSSWIHPSSFLLLGIPGLEELQFWLGLPFGTAYLIAVLGNVIILFVIYLEHSLHQP
MFYLLAILSATDLGLFTATVPRALG/ILVWLP*/LPLGTVAQMFFMHLFTGMETFILV
AMAFDCYIAICNPL*YNTILTTRMICIIAGVGLLRNFILVFPLIFLILRRSFCEHNIILH
TYCERMGIARLACISIKVNVLFGLILIYMILLDVILSALSYVKILHAVFKLPSWEARLKA
LNTCGSHVCMILAFFTPALFSFLAHRFGHNIPRYIHILLANLYIIIPLVLNPIIYGMRTK
QIQDRPVTILFSKEVLL