Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e54-ps Olfactory Receptor

Gene Symbol Or52e54-ps
Organism Mouse
Family 52
Subfamily e
Pseudo Yes
Location chr7:105004277-105004653 (-)
Aliases Olfr673-ps1

Sequence information


Nucleotide sequence

CACATTCTTAAAAGCTGTGAGCATCATATCCCTCATATTTTTTGTGAGCACATGGGCATT
GCCTGTTTAGTTTGTATCACCATCAGAATCAACATCATGTTTAGTCTTATCAATATTGCT
CTCTTGCTCCTGGATGTGGTTCTTATTATGCCTTCCTATGTCAGAATCCTAGTGTTCTGC
TACACTCCTGGGAGGCCAGGCTCAAGGCTTTCAATATCTGTGGTGCTCATATAGGTGTTA
TCTTCACAGTTTTTACTCCACCATTTTTCTCATTCTTGACACATTGTTTTGGCCACAATG
TATCCCAATATATCCACATTTTATTGGCCAGTCTTTATACAGTTGTCCCACTAGCCCTTA
ATTCTGTGATCTATGGT


Conceptual translation

HILKSCEHHIPHIFCEHMGIACLVCITIRINIMFSLINIALLLLDVVLIMPSYVRILV/
LLHSWEARLKAFNICGAHIGVIFTVFTPPFFSFLTHCFGHNVSQYIHILLASLYTVVPLA
LNSVIYG