Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52e55-ps Olfactory Receptor

Gene Symbol Or52e55-ps
Organism Rat
Family 52
Subfamily e
Pseudo Yes
Location chr1:169,887,000-169,887,000 (-)
Aliases Olr182-ps

Sequence information


Nucleotide sequence

atgggcatcatatcatctttcatagttattttgaacacatgcccttacccatctagtttg
tgcCAGTATCAGAGTCCCATCATATTTGGTCTTAGCAACGTTGCTCTCTAGATCCTGGAT
GTAGTTCTCACTATTCTCTCCTATGTCAGGATCCTCTAGGTAGTGTTCTGCTTTTCCTCC
TGTGAGGCCAGGCTCAAGGCTCTCAAAAACTGTGGTGCTCATGTAGCTGTTATCCTAAAC
TTTTTTACTCCAGAATTTTTTTCCTTCTTGACACATCATTTT


Conceptual translation

MGIISSFIVILNTCPYPSSLCQYQSPIIFGLSNVAL*ILDVVLTILSYVRIL*VVFCFSS
CEARLKALKNCGAHVAVILNFFTPEFFSFLTHHF\HHVPQYIYIFLTNSYVVVPPALIP
VICGVRTKQIQ*REMRIYSRKVTESDIRLKTEK