Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52e5b Olfactory Receptor

Gene Symbol Or52e5b
Organism Rat
Family 52
Subfamily e
Pseudo No
Location chr1:169,952,000-169,953,000 (+)
Aliases Olr189

Sequence information


Nucleotide sequence

ATGCTTCATTCCAACAAGACACAGTTCCACCCTTCCTCCTTCCTCCTGATAGGGATCCCA
GGGCTGGAAGATTTGCACCTTTGGATCGGCTTTCCCTTCTTTGCAGCGTATCTGATAGCC
GTCTTGGGGAACACCATCATCTTATTTGTGATCCAAACTGAACACAGCCTCCACCAACCT
ATGTTCTACTTTCTGGCCATGTTGGCATGCACCGATTTGGGTTTATCCACAGCCACCATC
CCCAAGATGCTGGGCATTTTCTGGTTCAATCTCGGGGAGATTACATTTGGAGCCTGCATC
ACTCAGATGTATACCATCCACCTATGCACCGGCCTGGAATCTGTGGTGCTGACAGTTATG
GCCATAGATCGTTATGTTGCTATATGTAACCCACTGAGGTACAGCATGATCCTCACCAAC
AAGGTGATAGCTATTCTGGGTGTACTCATCATAGTCAGAACTTTGGTATTTGTGACTCCG
TTTATATTTCTCATCTTTAGGTTGCCTTTCTGTGGTGTCCGAATTGTCCCACATACCTAC
TGTGAACACATGGGTTTGGCAAAGCTAGCTTGTGCTAATATCAGGGTCAATGTTATCTAT
GGATTGGTTGCTTTCTCAGTGGGATACATTGATCTATCTGTGATTGGATTTTCCTACATC
CGGATTCTCCAAGCAGTCTTCCGCCTTCCATCCTGGGATGCTCGGCTTAAGGCACTTAGC
ACATGTGGCTCCCATGTGAGTGTCATGTTGGCCTTTTACCTGCCAGCTCTCTTCTCATTC
ATGACACACCGCTTTGGCCACAACATCCCTCACTATATCCACATACTTCTAGCCAATCTG
TATGTGGTCGTTCCTCCTGCCCTGAACCCTGTTATCTATGGAGTCAGGACTAAACAGATA
AGGGAGAGAGTAGTAAGAATGCTTAACCCTAAGATGCAC


Conceptual translation

MLHSNKTQFHPSSFLLIGIPGLEDLHLWIGFPFFAAYLIAVLGNTIILFVIQTEHSLHQP
MFYFLAMLACTDLGLSTATIPKMLGIFWFNLGEITFGACITQMYTIHLCTGLESVVLTVM
AIDRYVAICNPLRYSMILTNKVIAILGVLIIVRTLVFVTPFIFLIFRLPFCGVRIVPHTY
CEHMGLAKLACANIRVNVIYGLVAFSVGYIDLSVIGFSYIRILQAVFRLPSWDARLKALS
TCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVVRMLNPKMH