Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52e7b-ps Olfactory Receptor

Gene Symbol Or52e7b-ps
Organism Rat
Family 52
Subfamily e
Pseudo Yes
Location chr1:169,927,000-169,928,000 (+)
Aliases Olr187-ps

Sequence information


Conceptual translation

MPSINLQQNVLSNVTEAHPLSFLLLGIPGPEATQFWLGFPFCVVYLIALVGNLIILFVIW
TDRTLHQPMFYFLAMLSVVGLSLSIATIPKMLSIFWLRL*ELCFECCVA*VFFIHFFKDM
ESIVLLAMGFDRYVAICNLVRYTTILKNRFICVISALMVIRSLYDFPH\FLLLRLPSCV
HSIIPHTYCEHMGMA*LACARIRDNVYFDLGNISILFLDVLITVSYAQILYAVFHLPSQD
ALLKALNMCNFHICVILAFFGPALFSFLTHCFGHNIPQYIHILLANLLVVI/PDFNPII
*GIRTKQIQQRLKSLFV