Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52f1 Olfactory Receptor

Gene Symbol Or52f1
Organism Mouse
Family 52
Subfamily f
Pseudo No
Location chr7:104167488-104168378 (-)
Aliases Olfr647

Sequence information


Nucleotide sequence

ATGCCCTGTAGGGACAGAGCCAAGTGGAAGCAGAAGATGGAGCTGGATCCTGCGGTGCCT
GCCCTTAAGAAGACACTTTCTGAGCCTGGGCCCTTTGTCCTATTGGGTGTGGCAGAACTT
GAGGGCCTGCATGCCTGGTTTTCTGTGCCCATGAGCTTGCTGTATCTGGTAGGGATGATA
GACACCTTCTCCTGGGGGTGGTGGCAGTTGACACAACCCTTCAGGCTCCCATGTACCAGC
TTTTGGGGGCTTCTGGCAGCTGCTGACTTAATTCTGGCCACATCTCCAGCACCTAAAGCT
CAAGCTGTGCTCTGGGGCTTGTTTGGAGAAATCTCCTTTGGAGGCTGGTTAGCTCAGTGC
TTTGTTGTTCATGTGGCCTTCACTGCTGAGTCCTCAGTGCTGCCAGCCATGGCAATGGAT
CACTCTGTGTCCATCAGACAGCCTCTATGCTATGGGGCTTTGCTGAGCCAGCATGTGGTG
GGCATAGTGGCTGCAGCAGCTGTGACTCATGGTGCCCGTGTCATGGCACCCCCTGTGGTC
CTTCTCCAGACACTCCCTCACTGTGGGCATCGGGCTTCGCCTCACACTTACTGTGAGCAT
ATGGGTGTGGCTTGTCTAGCATGTGATGACACATGTCCCAATATTTGGTTTGGACTGGCT
ACCACACTGCCCTCCCCAGTCCTGGACCTCGGGCTCATAGATGTTTCCTATGCCCTCATG
CTGTCAGTCGCCTGCTATGCCACAGCGCCCATTACAAGGCCTTGGGTAAACATGGGACTC
ATGCTGCTGGTCTCTTTTATAAACCTGCTCTCTTTTCTTTCCTGGCTTACTGTTGTGGCC
TCCATACAATTCCCAGCCACATCCACATCCTACTGGCAAATCTCTACGTGG


Conceptual translation

MPCRDRAKWKQKMELDPAVPALKKTLSEPGPFVLLGVAELEGLHAWFSVPMSLLYLVGMI
DTFSWGWWQLTQPFRLPCTSFWGLLAAADLILATSPAPKAQAVLWGLFGEISFGGWLAQC
FVVHVAFTAESSVLPAMAMDHSVSIRQPLCYGALLSQHVVGIVAAAAVTHGARVMAPPVV
LLQTLPHCGHRASPHTYCEHMGVACLACDDTCPNIWFGLATTLPSPVLDLGLIDVSYALM
LSVACYATAPITRPWVNMGLMLLVSFINLLSFLSWLTVVASIQFPATSTSYWQISTW