Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52h2 Olfactory Receptor

Gene Symbol Or52h2
Organism Mouse
Family 52
Subfamily h
Pseudo No
Location chr7:104,189,000-104,190,000 (-)
Aliases Olfr649

Sequence information


Nucleotide sequence

MVMHNVSSYNTGPFTLSGIPGLEQYHVWISIPFCFIYLVAILGNSILLYLIAVEHSLHSP
MFFFLSMLAMTDLILSTTCVPKTLSIFWFGPQEISFPGCLTQLFFLHYSFVLDSAILLAM
AFDRYVAICSPLRYTTILTPKTIVKIAVGISFRSFCVFVPCVFLVNRLPFCRTHIIAHTY
CEHIGVARLACADISINIWYGFCVPIMTVIIDVILIAISYTLILCAVFRLPSRDARQKAL
STCGSHVCVILMFYIPAFFSILAHRFGRNVPRTFHIMFANLYVIIPPALNPIVYGVKTKQ
IRDKAILLLFPK


Conceptual translation

MVMHNVSSYNTGPFTLSGIPGLEQYHVWISIPFCFIYLVAILGNSILLYLIAVEHSLHSP
MFFFLSMLAMTDLILSTTCVPKTLSIFWFGPQEISFPGCLTQLFFLHYSFVLDSAILLAM
AFDRYVAICSPLRYTTILTPKTIVKIAVGISFRSFCVFVPCVFLVNRLPFCRTHIIAHTY
CEHIGVARLACADISINIWYGFCVPIMTVIIDVILIAISYTLILCAVFRLPSRDARQKAL
STCGSHVCVILMFYIPAFFSILAHRFGRNVPRTFHIMFANLYVIIPPALNPIVYGVKTKQ
IRDKAILLLFPK