Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52h2 Olfactory Receptor

Gene Symbol Or52h2
Organism Rat
Family 52
Subfamily h
Pseudo No
Location chr1:169,386,000-169,387,000 (-)
Aliases Olr150

Sequence information


Nucleotide sequence

ATGTACAACATGAGTAGCTACAGCACTGGCCCCTTCACTCTCTCAGGCATCCCTGGTCTT
GAGCAATACCATGTCTGGATCAGTATTCCTTTCTGCTTTATCTATCTGGTGGCTATCCTG
GGCAACAGCATCCTTCTCTACCTCATCGCAGTGGAACGCAGTCTTCATTCCCCCATGTTC
TTCTTCCTTTCCATGTTGGCCATGACTGACCTCATCTTGTCCACTACCTGTGTCCCCAAG
ACCCTTAGCATCTTTTGGTTTGGTCCTCAGGAAATCAGTTTCCCTGGCTGTCTGACCCAG
TTATTCTTTCTGCACTATAGCTTTGTCTTGGACTCGGCTATCTTGCTGGCTATGGCATTT
GACCGCTATGTGGCCATCTGCTCACCCTTGAGGTATACCACTATTCTCACACCCAAAGCC
ACTGTTAAAATTGCAGTGGGAATCTCTTTCCGAAGTTTCTGTGTTTTTGTTCCATGCGTT
TTCCTTGTGAACCGTCTACCCTTCTGCAGGACACACGTCATTGCTCACACCTACTGTGAA
CACATTGGGGTTGCCCGGCTGGCATGTGCAGATATCTCCATCAACATCTGGTATGGGTTT
TGTGTGCCCATCATGACGGTGATCATAGATGTGGTCCTCATAGCCATCTCCTACACTCTC
ATTTTACATGCCGTTTTTCGCCTCCCGTCTCGGGATGCACGCCAGAAGGCCCTGGGCACC
TGCGGTTCTCATGTCTGTGTCATCCTCATGTTCTATATCCCGGCCTTCTTCTCCATCCTC
GCCCATCGCTTTGGGCGCAATGTCCCCCGCACTTTTCACATTATGTTTGCCAACCTGTAT
GTAATCATCCCACCCGCACTCAACCCTATGGTCTATGGAGTGAAGACCAAGCAGATCCGG
GACAAAGCCGTTCTTTTGCTCTTTCCCAAA


Conceptual translation

MYNMSSYSTGPFTLSGIPGLEQYHVWISIPFCFIYLVAILGNSILLYLIAVERSLHSPMF
FFLSMLAMTDLILSTTCVPKTLSIFWFGPQEISFPGCLTQLFFLHYSFVLDSAILLAMAF
DRYVAICSPLRYTTILTPKATVKIAVGISFRSFCVFVPCVFLVNRLPFCRTHVIAHTYCE
HIGVARLACADISINIWYGFCVPIMTVIIDVVLIAISYTLILHAVFRLPSRDARQKALGT
CGSHVCVILMFYIPAFFSILAHRFGRNVPRTFHIMFANLYVIIPPALNPMVYGVKTKQIR
DKAVLLLFPK